BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0332 (306 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z79757-6|CAB02127.1| 350|Caenorhabditis elegans Hypothetical pr... 27 3.4 AC024882-13|AAF60926.1| 342|Caenorhabditis elegans Seven tm rec... 25 7.9 >Z79757-6|CAB02127.1| 350|Caenorhabditis elegans Hypothetical protein F55B12.6 protein. Length = 350 Score = 26.6 bits (56), Expect = 3.4 Identities = 9/34 (26%), Positives = 17/34 (50%) Frame = -2 Query: 278 WIVILYYVILRKLVRLSVMNQSISTFNNYRYLFV 177 WI ++ + ++ ++ QS NYRYL + Sbjct: 13 WISFVFSICFNSILIFLIITQSPKKMGNYRYLMI 46 >AC024882-13|AAF60926.1| 342|Caenorhabditis elegans Seven tm receptor protein 164 protein. Length = 342 Score = 25.4 bits (53), Expect = 7.9 Identities = 9/34 (26%), Positives = 17/34 (50%) Frame = -2 Query: 278 WIVILYYVILRKLVRLSVMNQSISTFNNYRYLFV 177 W ++ + L L+ ++ +S NYRYL + Sbjct: 13 WTSFVFSICLNSLLIYLILTKSPKKMGNYRYLMI 46 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 5,634,889 Number of Sequences: 27780 Number of extensions: 81757 Number of successful extensions: 138 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 136 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 138 length of database: 12,740,198 effective HSP length: 71 effective length of database: 10,767,818 effective search space used: 323034540 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -