BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0326 (660 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659248-1|ABG47446.1| 496|Tribolium castaneum chitinase 8 prot... 23 2.9 AM269505-2|CAK30049.1| 12|Tribolium castaneum mlpt peptide 2 p... 22 3.9 >DQ659248-1|ABG47446.1| 496|Tribolium castaneum chitinase 8 protein. Length = 496 Score = 22.6 bits (46), Expect = 2.9 Identities = 23/86 (26%), Positives = 34/86 (39%), Gaps = 1/86 (1%) Frame = -3 Query: 535 IYLVQTD*EN-VVGYFVQIEQLLVNAGYSYEDTLIVACPTPEQISVFISSASLISHSEPV 359 I+ ++TD N + G QI +NA ++ PTPE + + SEP Sbjct: 360 IWSIETDDFNGLSGTKYQILNA-INAALKSDEIPPEPVPTPEP------QPTQTTESEPT 412 Query: 358 LPYGTKAKPSVVRKPSVTSVPEKLEE 281 + S +KP T PE E Sbjct: 413 QASEQPTESSTTQKPQTTKTPESGNE 438 >AM269505-2|CAK30049.1| 12|Tribolium castaneum mlpt peptide 2 protein. Length = 12 Score = 22.2 bits (45), Expect = 3.9 Identities = 8/10 (80%), Positives = 9/10 (90%) Frame = +1 Query: 205 GGKLRPSGQY 234 GGKL P+GQY Sbjct: 3 GGKLDPTGQY 12 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 129,468 Number of Sequences: 336 Number of extensions: 2580 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17073220 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -