BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0325 (677 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_56937| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.65 SB_11691| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.86 SB_45137| Best HMM Match : Involucrin2 (HMM E-Value=0.59) 29 4.6 SB_40629| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.6 SB_24771| Best HMM Match : RVT_1 (HMM E-Value=0) 29 4.6 SB_13410| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.6 SB_40775| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.0 >SB_56937| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 761 Score = 31.5 bits (68), Expect = 0.65 Identities = 13/31 (41%), Positives = 16/31 (51%), Gaps = 1/31 (3%) Frame = +3 Query: 369 VTAPYGIAAPYGIAAPYTAYGAYGVA-PYSL 458 +T PYGI PY I PY Y + PY + Sbjct: 583 ITCPYGITYPYDITCPYNITCPYDITWPYDI 613 Score = 31.5 bits (68), Expect = 0.65 Identities = 13/31 (41%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Frame = +3 Query: 369 VTAPYGIAAPYGIAAPYTAYGAYGV-APYSL 458 +T PYGI YGI PY +G+ PY + Sbjct: 619 ITCPYGITCLYGITCPYGITCQFGITCPYDI 649 Score = 30.3 bits (65), Expect = 1.5 Identities = 17/38 (44%), Positives = 20/38 (52%), Gaps = 6/38 (15%) Frame = +3 Query: 369 VTAPYGIAAPYGIAAPY---TAYG---AYGVAPYSLGV 464 +T PY I PY I PY YG AYG+ YS G+ Sbjct: 463 ITCPYDITCPYDIKCPYDITCLYGFTCAYGIT-YSFGI 499 Score = 29.9 bits (64), Expect = 2.0 Identities = 12/31 (38%), Positives = 16/31 (51%), Gaps = 1/31 (3%) Frame = +3 Query: 369 VTAPYGIAAPYGIAAPYTAYGAYGV-APYSL 458 +T PYGI +GI PY Y + PY + Sbjct: 631 ITCPYGITCQFGITCPYDITCPYDITCPYDI 661 Score = 29.1 bits (62), Expect = 3.5 Identities = 13/31 (41%), Positives = 16/31 (51%), Gaps = 1/31 (3%) Frame = +3 Query: 369 VTAPYGIAAPYGIAAPYTAYGAYGV-APYSL 458 +T PY I PY I PY YG+ PY + Sbjct: 607 ITWPYDITWPYDITCPYGITCLYGITCPYGI 637 Score = 29.1 bits (62), Expect = 3.5 Identities = 12/31 (38%), Positives = 15/31 (48%), Gaps = 1/31 (3%) Frame = +3 Query: 369 VTAPYGIAAPYGIAAPYTAYGAYGVA-PYSL 458 +T PY I PY I PY Y + PY + Sbjct: 643 ITCPYDITCPYDITCPYDITCPYDITYPYDI 673 Score = 28.7 bits (61), Expect = 4.6 Identities = 12/31 (38%), Positives = 15/31 (48%), Gaps = 1/31 (3%) Frame = +3 Query: 369 VTAPYGIAAPYGIAAPYTAYGAYGVA-PYSL 458 +T PY I PY I PY Y + PY + Sbjct: 499 ITCPYDITCPYDITCPYYITCPYDITYPYDI 529 Score = 28.7 bits (61), Expect = 4.6 Identities = 12/31 (38%), Positives = 15/31 (48%), Gaps = 1/31 (3%) Frame = +3 Query: 369 VTAPYGIAAPYGIAAPYTAYGAYGV-APYSL 458 +T PY I PY I PY Y + PY + Sbjct: 595 ITCPYNITCPYDITWPYDITWPYDITCPYGI 625 Score = 28.3 bits (60), Expect = 6.0 Identities = 12/31 (38%), Positives = 15/31 (48%), Gaps = 1/31 (3%) Frame = +3 Query: 369 VTAPYGIAAPYGIAAPYTAYGAYGVA-PYSL 458 +T PY I PY I PY Y + PY + Sbjct: 517 ITCPYDITYPYDITCPYDITCPYDITYPYDI 547 Score = 28.3 bits (60), Expect = 6.0 Identities = 12/31 (38%), Positives = 15/31 (48%), Gaps = 1/31 (3%) Frame = +3 Query: 369 VTAPYGIAAPYGIAAPYTAYGAYGVA-PYSL 458 +T PY I PY I PY Y + PY + Sbjct: 715 ITYPYDITCPYHITCPYDITWPYDITWPYDI 745 Score = 27.9 bits (59), Expect = 8.0 Identities = 12/31 (38%), Positives = 15/31 (48%), Gaps = 1/31 (3%) Frame = +3 Query: 369 VTAPYGIAAPYGIAAPYTAYGAYGV-APYSL 458 +T PY I PY I PY Y + PY + Sbjct: 529 ITCPYDITCPYDITYPYDITYPYDITCPYHI 559 Score = 27.9 bits (59), Expect = 8.0 Identities = 12/31 (38%), Positives = 15/31 (48%), Gaps = 1/31 (3%) Frame = +3 Query: 369 VTAPYGIAAPYGIAAPYTAYGAYGV-APYSL 458 +T PY I PY I PY Y + PY + Sbjct: 547 ITYPYDITCPYHITCPYDITCPYDIKCPYDI 577 Score = 27.9 bits (59), Expect = 8.0 Identities = 11/25 (44%), Positives = 13/25 (52%) Frame = +3 Query: 369 VTAPYGIAAPYGIAAPYTAYGAYGV 443 +T PY I PY I PY YG+ Sbjct: 667 ITYPYDITYPYDITCPYYITCPYGI 691 Score = 27.9 bits (59), Expect = 8.0 Identities = 12/31 (38%), Positives = 15/31 (48%), Gaps = 1/31 (3%) Frame = +3 Query: 369 VTAPYGIAAPYGIAAPYTAYGAYGV-APYSL 458 +T PYGI Y I PY Y + PY + Sbjct: 685 ITCPYGITCQYDITCPYHITCPYHITCPYDI 715 Score = 27.9 bits (59), Expect = 8.0 Identities = 12/31 (38%), Positives = 15/31 (48%), Gaps = 1/31 (3%) Frame = +3 Query: 369 VTAPYGIAAPYGIAAPYTAYGAYGV-APYSL 458 +T PY I PY I PY Y + PY + Sbjct: 697 ITCPYHITCPYHITCPYDITYPYDITCPYHI 727 >SB_11691| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1448 Score = 31.1 bits (67), Expect = 0.86 Identities = 14/30 (46%), Positives = 14/30 (46%), Gaps = 1/30 (3%) Frame = +3 Query: 375 APYGIAAPYGIAAPYTAYGAYGV-APYSLG 461 APY PY I PY Y APYS G Sbjct: 1335 APYNTGEPYNIGVPYNTGAPYNTGAPYSTG 1364 Score = 27.9 bits (59), Expect = 8.0 Identities = 12/29 (41%), Positives = 12/29 (41%), Gaps = 1/29 (3%) Frame = +3 Query: 378 PYGIAAPYGIAAPYTAYGAYGVA-PYSLG 461 PY I PY APY Y PY G Sbjct: 1342 PYNIGVPYNTGAPYNTGAPYSTGEPYRTG 1370 >SB_45137| Best HMM Match : Involucrin2 (HMM E-Value=0.59) Length = 421 Score = 28.7 bits (61), Expect = 4.6 Identities = 12/29 (41%), Positives = 16/29 (55%), Gaps = 1/29 (3%) Frame = +3 Query: 375 APYGIAAPYGIAAPYTAYGAYGV-APYSL 458 AP+G+ PYG + P + YG PY L Sbjct: 381 APFGLQVPYGYSVPCSLQTPYGYPVPYGL 409 >SB_40629| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 182 Score = 28.7 bits (61), Expect = 4.6 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = -2 Query: 559 SIISAIKKKACYFCIADLEN 500 S+I K++ CYFC D+EN Sbjct: 151 SLIKNCKEQTCYFCCDDIEN 170 >SB_24771| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 1387 Score = 28.7 bits (61), Expect = 4.6 Identities = 12/29 (41%), Positives = 16/29 (55%), Gaps = 1/29 (3%) Frame = +3 Query: 375 APYGIAAPYGIAAPYTAYGAYGV-APYSL 458 AP+G+ PYG + P + YG PY L Sbjct: 1224 APFGLQVPYGYSVPCSLQTPYGYPVPYGL 1252 >SB_13410| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1984 Score = 28.7 bits (61), Expect = 4.6 Identities = 12/29 (41%), Positives = 16/29 (55%), Gaps = 1/29 (3%) Frame = +3 Query: 375 APYGIAAPYGIAAPYTAYGAYGV-APYSL 458 AP+G+ PYG + P + YG PY L Sbjct: 1449 APFGLQVPYGYSVPCSLQTPYGYPVPYGL 1477 >SB_40775| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 712 Score = 27.9 bits (59), Expect = 8.0 Identities = 13/34 (38%), Positives = 21/34 (61%) Frame = -1 Query: 647 IVTRPDRRPARRCQLLKHLIVDKADRATLFNNIC 546 ++ RP +R ARR + + + DK RAT+F+ C Sbjct: 635 LLCRPAKRRARRSRKKRIVRRDKLPRATIFHRRC 668 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,286,550 Number of Sequences: 59808 Number of extensions: 161272 Number of successful extensions: 713 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 538 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 686 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1745338465 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -