BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0321 (658 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q8II55 Cluster: Putative uncharacterized protein; n=2; ... 33 6.0 >UniRef50_Q8II55 Cluster: Putative uncharacterized protein; n=2; Plasmodium|Rep: Putative uncharacterized protein - Plasmodium falciparum (isolate 3D7) Length = 1352 Score = 33.1 bits (72), Expect = 6.0 Identities = 19/58 (32%), Positives = 26/58 (44%), Gaps = 1/58 (1%) Frame = -2 Query: 423 NQNDLSKDKVHHK-RLKCTVFYKNVLHYLM*YKVDEYMFNLNVYLYILMEFHYCSCIT 253 N ND K+ K R K + YK LH K + +M+ N Y Y + Y CI+ Sbjct: 1007 NNNDNDNKKIEEKCRDKLKIIYKEKLHITNVEKNNTHMYYYNKYDYFINYVKYIYCIS 1064 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 508,697,705 Number of Sequences: 1657284 Number of extensions: 9027078 Number of successful extensions: 17268 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 16494 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17236 length of database: 575,637,011 effective HSP length: 98 effective length of database: 413,223,179 effective search space used: 49586781480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -