BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0321 (658 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. 27 0.52 AY705404-1|AAU12513.1| 406|Anopheles gambiae nicotinic acetylch... 24 3.7 AY347952-1|AAR28375.1| 634|Anopheles gambiae putative sulfakini... 23 8.5 >CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. Length = 1494 Score = 27.1 bits (57), Expect = 0.52 Identities = 19/59 (32%), Positives = 30/59 (50%), Gaps = 4/59 (6%) Frame = +3 Query: 267 SSEIPLKYINIHLN*TCIHLLCITLNNEEHSYKKRYISVVC----DVLYLCLSHFDFIY 431 SS LK I + + C+H IT+N+E S+ K + V C D+ + ++ FIY Sbjct: 241 SSSFFLKAIRVE-SPPCLHYRAITVNSEWRSFIKIFEGVRCLFTSDIYVIPITTRHFIY 298 >AY705404-1|AAU12513.1| 406|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 9 protein. Length = 406 Score = 24.2 bits (50), Expect = 3.7 Identities = 10/22 (45%), Positives = 15/22 (68%) Frame = -3 Query: 476 HITILLTVTNITHTQINKIKMT 411 ++T + T ITH +IN+IK T Sbjct: 61 NVTTVETGITITHVEINEIKST 82 >AY347952-1|AAR28375.1| 634|Anopheles gambiae putative sulfakinin GPCR protein. Length = 634 Score = 23.0 bits (47), Expect = 8.5 Identities = 8/19 (42%), Positives = 13/19 (68%) Frame = -2 Query: 105 FTQKMERMVFYLLVEIYTC 49 F K+ RM+F ++VE + C Sbjct: 460 FFAKVIRMLFVIIVEFFVC 478 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 555,681 Number of Sequences: 2352 Number of extensions: 9678 Number of successful extensions: 64 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 63 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 64 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 65232180 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -