BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0319 (657 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090820-2|BAC57916.1| 1222|Anopheles gambiae reverse transcript... 27 0.69 AJ276486-1|CAB90818.1| 364|Anopheles gambiae serine protease pr... 24 3.7 AF444783-1|AAL37904.1| 1356|Anopheles gambiae Trex protein. 24 4.9 AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative different... 23 6.4 AJ439060-4|CAD27755.1| 151|Anopheles gambiae putative sRNP prot... 23 8.5 >AB090820-2|BAC57916.1| 1222|Anopheles gambiae reverse transcriptase protein. Length = 1222 Score = 26.6 bits (56), Expect = 0.69 Identities = 20/64 (31%), Positives = 25/64 (39%) Frame = +2 Query: 458 ERGLQRQRAKNRLSGRWPLREPSP*SSFLGSRCRKALNRNPKGSPRFKAWPGKPANVARK 637 E G + +RLSG W RE SS L ++P WP P V + Sbjct: 358 ETGQWYRNVLSRLSGSWTARERD--SSVLEVIVSTLFPQHPPVD-----WPASPGQVLER 410 Query: 638 GREE 649 G EE Sbjct: 411 GEEE 414 >AJ276486-1|CAB90818.1| 364|Anopheles gambiae serine protease protein. Length = 364 Score = 24.2 bits (50), Expect = 3.7 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = -1 Query: 270 ATVGKAIGAGLFAITPAGERGMC 202 ATVG+++ +G TP+G G C Sbjct: 19 ATVGQSLNSGDPCQTPSGTAGTC 41 >AF444783-1|AAL37904.1| 1356|Anopheles gambiae Trex protein. Length = 1356 Score = 23.8 bits (49), Expect = 4.9 Identities = 13/36 (36%), Positives = 18/36 (50%) Frame = +1 Query: 160 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRLPNS 267 +W NP T + AHP + + + EAR LP S Sbjct: 321 EWINPA-TFPGVVQAHPARSFKQQNNEARAHHLPRS 355 >AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative differentiation regulator protein. Length = 1283 Score = 23.4 bits (48), Expect = 6.4 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +1 Query: 169 NPGVTQLNRLAAHPPFASWRNS 234 +PG +L+ HPP AS R+S Sbjct: 835 HPGAQTQPQLSQHPPGASGRSS 856 >AJ439060-4|CAD27755.1| 151|Anopheles gambiae putative sRNP protein. Length = 151 Score = 23.0 bits (47), Expect = 8.5 Identities = 15/50 (30%), Positives = 25/50 (50%) Frame = +2 Query: 128 TIHWPSFYNVVTGKTLALPNLIALQHIPLSPAGVIAKRPAPIAFPTVAQP 277 T++ P ++ G A P L+ + PL P ++ RP P+ PT+ P Sbjct: 82 TMNMPPRPGMIPGMPGAPPLLMG-PNGPLPPP-MMGMRPPPMMVPTMGMP 129 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 692,125 Number of Sequences: 2352 Number of extensions: 15859 Number of successful extensions: 30 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 28 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 30 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 65232180 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -