BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0318 (692 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB023025-1|BAA74592.1| 133|Apis mellifera actin protein. 158 5e-41 AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced prot... 23 2.1 AB181702-1|BAE06051.1| 628|Apis mellifera acetylcholinesterase ... 23 3.6 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 23 3.6 AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic ac... 22 4.8 EF051030-1|ABN05618.1| 118|Apis mellifera phosphoenolpyruvate c... 21 8.4 AB072429-1|BAB83990.1| 388|Apis mellifera IP3phosphatase protein. 21 8.4 >AB023025-1|BAA74592.1| 133|Apis mellifera actin protein. Length = 133 Score = 158 bits (383), Expect = 5e-41 Identities = 82/121 (67%), Positives = 87/121 (71%) Frame = +3 Query: 312 EMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKC 491 EMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKC Sbjct: 1 EMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKC 60 Query: 492 DVDIRKXXXXXXXXXXXXXXXLESPTRMQKEITSFSPHRQ*RIKNIGSPERKVLPYGSGG 671 DVDIRK RMQKEIT+ +P +IK I PE+K + G Sbjct: 61 DVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTM-KIKIIAPPEKKYSVWIGGS 119 Query: 672 I 674 I Sbjct: 120 I 120 >AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced protein 75 protein. Length = 900 Score = 23.4 bits (48), Expect = 2.1 Identities = 11/38 (28%), Positives = 16/38 (42%) Frame = +1 Query: 319 PPLHPAAPSRSLTNFPTVRSSLSETKDSVAQRLSSNPR 432 PP + + P S LS T ++A+ L PR Sbjct: 678 PPARSPSSQAQASQCPQTASLLSSTHSTLARSLMEGPR 715 >AB181702-1|BAE06051.1| 628|Apis mellifera acetylcholinesterase protein. Length = 628 Score = 22.6 bits (46), Expect = 3.6 Identities = 9/24 (37%), Positives = 16/24 (66%) Frame = +2 Query: 590 KLFAPSTMKNKEHWFSREESTSVW 661 +LFA MK ++F++ ST++W Sbjct: 465 QLFADRGMKVYYYFFTQRTSTNLW 488 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 22.6 bits (46), Expect = 3.6 Identities = 12/44 (27%), Positives = 21/44 (47%) Frame = +3 Query: 60 AVRVRSYHRYRAGLRRRCLPHRAHLRRIRTPPRHPASGLSRSRP 191 ++ +++HR C P +L +I + P HP + S S P Sbjct: 62 SLTAQAHHRLYPAFSSSCDPVPGNLEQIGSRPLHPPAS-STSLP 104 >AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic acetylcholine receptoralpha7-1 protein. Length = 555 Score = 22.2 bits (45), Expect = 4.8 Identities = 12/34 (35%), Positives = 12/34 (35%), Gaps = 1/34 (2%) Frame = +3 Query: 147 TP-PRHPASGLSRSRPHRLPHEDPHRARLLVHYH 245 TP P H G S H PH A H H Sbjct: 411 TPGPHHHTMGHGHSHIHATPHHHHSHAATPHHQH 444 >EF051030-1|ABN05618.1| 118|Apis mellifera phosphoenolpyruvate carboxykinase protein. Length = 118 Score = 21.4 bits (43), Expect = 8.4 Identities = 10/31 (32%), Positives = 15/31 (48%) Frame = -3 Query: 120 VGDTVAGVQHDTGGTTGRVQREHGLDGDVHG 28 VGD +A ++ D G + E+G G G Sbjct: 42 VGDDIAWMKFDKEGRLRAINPEYGFFGVAPG 72 >AB072429-1|BAB83990.1| 388|Apis mellifera IP3phosphatase protein. Length = 388 Score = 21.4 bits (43), Expect = 8.4 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = -2 Query: 652 STFLSGEPMFFILHCR 605 ST L +P F LHC+ Sbjct: 35 STILRLDPKFIALHCQ 50 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 223,093 Number of Sequences: 438 Number of extensions: 5463 Number of successful extensions: 16 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21195810 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -