BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0316 (648 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1002.13c |psu1||beta-glucosidase Psu1 |Schizosaccharomyces p... 28 1.3 SPCC1494.07 |||conserved eukaryotic protein|Schizosaccharomyces ... 27 2.3 SPAC10F6.01c ||SPAC4C5.05c|sulfite reductase beta subunit |Schiz... 27 3.1 SPCC18B5.07c |nup61||nucleoporin Nup61|Schizosaccharomyces pombe... 26 5.4 SPAC1F12.10c |||NADPH-hemoprotein reductase |Schizosaccharomyces... 26 5.4 SPAC12G12.03 |cip2||RNA-binding protein Cip2|Schizosaccharomyces... 25 7.1 SPCC970.07c |raf2|dos2, cmc2, clr7|Rik1-associated factor Raf2|S... 25 9.4 >SPAC1002.13c |psu1||beta-glucosidase Psu1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 417 Score = 27.9 bits (59), Expect = 1.3 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = -3 Query: 496 TPEVGVSW*TTSVQKVNGSPEVFGGQVQDG 407 T E G W T+S N SP VFG + DG Sbjct: 326 TAEQGCQWGTSSGDYGNWSPLVFGAGMTDG 355 >SPCC1494.07 |||conserved eukaryotic protein|Schizosaccharomyces pombe|chr 3|||Manual Length = 1502 Score = 27.1 bits (57), Expect = 2.3 Identities = 10/33 (30%), Positives = 18/33 (54%) Frame = +1 Query: 109 VVAQLDIPVIHSSNVLKL*LHQHLPQSLATHHL 207 + Q D+P +H+ N LK +H S++ +L Sbjct: 819 IAGQFDLPQVHAMNTLKTIFTEHRLSSVSVEYL 851 >SPAC10F6.01c ||SPAC4C5.05c|sulfite reductase beta subunit |Schizosaccharomyces pombe|chr 1|||Manual Length = 1473 Score = 26.6 bits (56), Expect = 3.1 Identities = 10/30 (33%), Positives = 12/30 (40%) Frame = -2 Query: 158 FRTLDEWITGISNWATTNRNMVLHSAFCFK 69 F + WI G WA N LH C + Sbjct: 518 FTNVSHWIIGSDAWAYDLGNSALHQVLCLE 547 >SPCC18B5.07c |nup61||nucleoporin Nup61|Schizosaccharomyces pombe|chr 3|||Manual Length = 565 Score = 25.8 bits (54), Expect = 5.4 Identities = 10/27 (37%), Positives = 16/27 (59%) Frame = +3 Query: 429 NTSGDPFTFCTEVVHQDTPTSGVFSFA 509 NT+ +PF F + + P + VFSF+ Sbjct: 264 NTAANPFAFAKKENEESKPLTPVFSFS 290 >SPAC1F12.10c |||NADPH-hemoprotein reductase |Schizosaccharomyces pombe|chr 1|||Manual Length = 147 Score = 25.8 bits (54), Expect = 5.4 Identities = 14/36 (38%), Positives = 18/36 (50%) Frame = -3 Query: 385 IALVPQAPGHGSTHFPP*QVRVGEHSPLVEHSSLQP 278 +AL + G H P Q+R+ S VEHS QP Sbjct: 2 VALFKSSLGRPEQHQTP-QIRISPASSNVEHSEKQP 36 >SPAC12G12.03 |cip2||RNA-binding protein Cip2|Schizosaccharomyces pombe|chr 1|||Manual Length = 576 Score = 25.4 bits (53), Expect = 7.1 Identities = 21/62 (33%), Positives = 30/62 (48%), Gaps = 5/62 (8%) Frame = -3 Query: 352 STHFPP*QVRVGEHSPLV--EHSSLQPYVWISEITCAHVQRPALHKALLPQG---DGLQG 188 STHF P HSPL+ S+L P S + +++ +P+L L G +GL Sbjct: 420 STHFTPANNSSANHSPLMAPNASTLNP----SSLGASNLSQPSLANHLSSSGLFDNGLFS 475 Query: 187 SG 182 SG Sbjct: 476 SG 477 >SPCC970.07c |raf2|dos2, cmc2, clr7|Rik1-associated factor Raf2|Schizosaccharomyces pombe|chr 3|||Manual Length = 636 Score = 25.0 bits (52), Expect = 9.4 Identities = 13/27 (48%), Positives = 15/27 (55%), Gaps = 6/27 (22%) Frame = -3 Query: 112 LQIGIWSCTRHSAL------NPHDPSQ 50 LQ GIWSC + L NP+ PSQ Sbjct: 572 LQTGIWSCPVQNCLYFAVCDNPYKPSQ 598 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,998,378 Number of Sequences: 5004 Number of extensions: 68460 Number of successful extensions: 158 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 154 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 158 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 291768710 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -