BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0310 (541 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292349-1|CAL23161.1| 248|Tribolium castaneum gustatory recept... 22 4.0 DQ414248-1|ABD63010.2| 311|Tribolium castaneum sloppy-paired pr... 21 6.9 AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 21 6.9 AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. 21 6.9 AJ850290-1|CAH64510.1| 533|Tribolium castaneum putative esteras... 21 9.2 AJ850289-1|CAH64509.1| 533|Tribolium castaneum putative esteras... 21 9.2 AJ850288-1|CAH64508.1| 510|Tribolium castaneum putative esteras... 21 9.2 AJ850287-1|CAH64507.1| 509|Tribolium castaneum putative esteras... 21 9.2 >AM292349-1|CAL23161.1| 248|Tribolium castaneum gustatory receptor candidate 28 protein. Length = 248 Score = 21.8 bits (44), Expect = 4.0 Identities = 9/25 (36%), Positives = 12/25 (48%) Frame = +2 Query: 335 DQDYFSSCFLSIFLLVHNRSWITIF 409 D+ YF F S+F L+ W F Sbjct: 219 DEMYFRVAFPSVFTLIDYSLWKACF 243 >DQ414248-1|ABD63010.2| 311|Tribolium castaneum sloppy-paired protein. Length = 311 Score = 21.0 bits (42), Expect = 6.9 Identities = 12/39 (30%), Positives = 18/39 (46%) Frame = -3 Query: 353 WRNSLGHNRMMRHKRTMVQRRTNMLGQ*HMSMLCSSIRD 237 W+NS+ HN + V R + G+ + ML S D Sbjct: 127 WQNSIRHNLSLNKCFVKVPRHYDDPGKGNYWMLDPSAED 165 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 21.0 bits (42), Expect = 6.9 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -2 Query: 114 LPQQEPR*RGCKPREQL 64 L QQ + C+PREQL Sbjct: 580 LDQQNQWCKPCRPREQL 596 >AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. Length = 682 Score = 21.0 bits (42), Expect = 6.9 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -2 Query: 114 LPQQEPR*RGCKPREQL 64 L QQ + C+PREQL Sbjct: 472 LDQQNQWCKPCRPREQL 488 >AJ850290-1|CAH64510.1| 533|Tribolium castaneum putative esterase protein. Length = 533 Score = 20.6 bits (41), Expect = 9.2 Identities = 8/24 (33%), Positives = 12/24 (50%) Frame = +3 Query: 270 LLAQHIRTPLHHRTLMPHHPVVTK 341 L A+ + P + PH PV+ K Sbjct: 263 LAAEKVHDPFIASLVRPHGPVIEK 286 >AJ850289-1|CAH64509.1| 533|Tribolium castaneum putative esterase protein. Length = 533 Score = 20.6 bits (41), Expect = 9.2 Identities = 8/24 (33%), Positives = 12/24 (50%) Frame = +3 Query: 270 LLAQHIRTPLHHRTLMPHHPVVTK 341 L A+ + P + PH PV+ K Sbjct: 263 LAAEKVHDPFIASLVRPHGPVIEK 286 >AJ850288-1|CAH64508.1| 510|Tribolium castaneum putative esterase protein. Length = 510 Score = 20.6 bits (41), Expect = 9.2 Identities = 8/24 (33%), Positives = 12/24 (50%) Frame = +3 Query: 270 LLAQHIRTPLHHRTLMPHHPVVTK 341 L A+ + P + PH PV+ K Sbjct: 263 LAAEKVHDPFIASLVRPHGPVIEK 286 >AJ850287-1|CAH64507.1| 509|Tribolium castaneum putative esterase protein. Length = 509 Score = 20.6 bits (41), Expect = 9.2 Identities = 8/24 (33%), Positives = 12/24 (50%) Frame = +3 Query: 270 LLAQHIRTPLHHRTLMPHHPVVTK 341 L A+ + P + PH PV+ K Sbjct: 262 LAAEKVHDPFIASLVRPHGPVIEK 285 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 89,536 Number of Sequences: 336 Number of extensions: 1429 Number of successful extensions: 8 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 13201902 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -