BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0305 (518 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholi... 23 2.5 DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholi... 23 2.5 AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. 21 5.7 >DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 22.6 bits (46), Expect = 2.5 Identities = 9/30 (30%), Positives = 16/30 (53%) Frame = -1 Query: 92 HGFLFSNHQEESLFSRLFSIYHKVIMSTLN 3 HG + N + L+ L S Y+K++ +N Sbjct: 20 HGAVAGNPDAKRLYDDLLSNYNKLVRPVVN 49 >DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 22.6 bits (46), Expect = 2.5 Identities = 9/30 (30%), Positives = 16/30 (53%) Frame = -1 Query: 92 HGFLFSNHQEESLFSRLFSIYHKVIMSTLN 3 HG + N + L+ L S Y+K++ +N Sbjct: 20 HGAVAGNPDAKRLYDDLLSNYNKLVRPVVN 49 >AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. Length = 898 Score = 21.4 bits (43), Expect = 5.7 Identities = 11/28 (39%), Positives = 17/28 (60%), Gaps = 2/28 (7%) Frame = -1 Query: 101 VHSHGFLFS--NHQEESLFSRLFSIYHK 24 +++H L S NH +E L S +FS Y + Sbjct: 220 LYNHARLMSQDNHSKEYLVSIMFSHYDR 247 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 125,552 Number of Sequences: 438 Number of extensions: 2080 Number of successful extensions: 5 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14477538 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -