BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0303 (606 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_17237| Best HMM Match : No HMM Matches (HMM E-Value=.) 109 2e-24 SB_30142| Best HMM Match : No HMM Matches (HMM E-Value=.) 106 1e-23 SB_43825| Best HMM Match : No HMM Matches (HMM E-Value=.) 106 1e-23 SB_3496| Best HMM Match : Herpes_UL49_5 (HMM E-Value=7.2) 104 6e-23 SB_36241| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 1e-22 SB_12310| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 5e-22 SB_3970| Best HMM Match : Drf_FH1 (HMM E-Value=1.2) 101 5e-22 SB_47433| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 2e-21 SB_43660| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 4e-21 SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) 97 7e-21 SB_39201| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_47276| Best HMM Match : DUF851 (HMM E-Value=9.6) 97 1e-20 SB_17747| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 2e-20 SB_41613| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 2e-20 SB_35835| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 2e-20 SB_16265| Best HMM Match : Vicilin_N (HMM E-Value=3.3) 95 3e-20 SB_32211| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 3e-20 SB_1214| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 3e-20 SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 95 5e-20 SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 95 5e-20 SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_57634| Best HMM Match : EGF_2 (HMM E-Value=0.0014) 95 5e-20 SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_57287| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) 95 5e-20 SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) 95 5e-20 SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) 95 5e-20 SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) 95 5e-20 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) 95 5e-20 SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 95 5e-20 SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1) 95 5e-20 SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3) 95 5e-20 SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) 95 5e-20 SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) 95 5e-20 SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_52260| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_52253| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_52086| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) 95 5e-20 SB_51989| Best HMM Match : Extensin_2 (HMM E-Value=0.29) 95 5e-20 SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_51427| Best HMM Match : DUF855 (HMM E-Value=4) 95 5e-20 SB_51409| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_51320| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) 95 5e-20 SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_50493| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_50417| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_50270| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_49896| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_49839| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_49814| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_49530| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_49465| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_49395| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_49211| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_49150| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) 95 5e-20 SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_48522| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_48514| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_48486| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_48129| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_48100| Best HMM Match : Transformer (HMM E-Value=5.4) 95 5e-20 SB_48063| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_48045| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016) 95 5e-20 SB_47536| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_47480| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_47399| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_47213| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_46889| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) 95 5e-20 SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_46649| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_46589| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_46529| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_46517| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_46424| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_46412| Best HMM Match : HEAT (HMM E-Value=8) 95 5e-20 SB_46374| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_46344| Best HMM Match : ig (HMM E-Value=0.0082) 95 5e-20 SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) 95 5e-20 SB_46308| Best HMM Match : IMS (HMM E-Value=0) 95 5e-20 SB_46303| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_45887| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_45813| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_45524| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_45424| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_45381| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_45291| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_44920| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_44894| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_44806| Best HMM Match : Hist_deacetyl (HMM E-Value=0) 95 5e-20 SB_44800| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_44789| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) 95 5e-20 SB_44606| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_44466| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_44411| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_44401| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_44392| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_44358| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_44259| Best HMM Match : MORN (HMM E-Value=3.7) 95 5e-20 SB_44076| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_44013| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_43970| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) 95 5e-20 SB_43909| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_43701| Best HMM Match : ubiquitin (HMM E-Value=0.003) 95 5e-20 SB_43671| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_43630| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_43618| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_43569| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_43145| Best HMM Match : PEGSRP (HMM E-Value=7.2) 95 5e-20 SB_43138| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.3e-14) 95 5e-20 SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_42990| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_42937| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_42936| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_42831| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) 95 5e-20 SB_42725| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_42655| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8) 95 5e-20 SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_42313| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_42158| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_42069| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_42015| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_41881| Best HMM Match : Extensin_1 (HMM E-Value=5.5) 95 5e-20 SB_41827| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_41806| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_41779| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_41728| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_41712| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_41568| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_41481| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_41365| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_41011| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_40939| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_40610| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_40566| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_40471| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_40462| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_40265| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_40240| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_40230| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_40107| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_39690| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_39438| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_39406| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_39373| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_39311| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_39107| Best HMM Match : Lyase_8 (HMM E-Value=0.016) 95 5e-20 SB_38948| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_38916| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_38893| Best HMM Match : UMPH-1 (HMM E-Value=2.3e-21) 95 5e-20 SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) 95 5e-20 SB_38726| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_38504| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_38387| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_38141| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_38016| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_37962| Best HMM Match : Tcp10_C (HMM E-Value=5.9e-36) 95 5e-20 SB_37690| Best HMM Match : IgG_binding_B (HMM E-Value=4.2) 95 5e-20 SB_37661| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_37635| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_37536| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_37412| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_37372| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9) 95 5e-20 SB_37147| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_37066| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_37038| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_37030| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_36958| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_36941| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_36865| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_36853| Best HMM Match : DNA_pol_B_exo (HMM E-Value=4.2) 95 5e-20 SB_36823| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_36358| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_35997| Best HMM Match : Phage_fiber (HMM E-Value=0.78) 95 5e-20 SB_35988| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_35856| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_35768| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_35732| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_35726| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_35698| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_35689| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_35635| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_35611| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_35484| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_35280| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) 95 5e-20 SB_35237| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_35223| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_35140| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_35136| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_35129| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_35057| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_35026| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_34829| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_34793| Best HMM Match : TIL (HMM E-Value=4.5) 95 5e-20 SB_34738| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_34683| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_34666| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_34501| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_34487| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_34462| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_34192| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_34190| Best HMM Match : MAM (HMM E-Value=0) 95 5e-20 SB_34054| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_34015| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_33934| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_33883| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_33752| Best HMM Match : I-set (HMM E-Value=3.7e-15) 95 5e-20 SB_33698| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_33625| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_33491| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_33475| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_33403| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_33369| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_33319| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_33270| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_33216| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_33186| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_32832| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_32674| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_32571| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_32529| Best HMM Match : Laminin_G_2 (HMM E-Value=0) 95 5e-20 SB_32525| Best HMM Match : DED (HMM E-Value=0.81) 95 5e-20 SB_32508| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_32440| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_32437| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_32426| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_32411| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_32339| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_32317| Best HMM Match : Cadherin (HMM E-Value=1.5e-28) 95 5e-20 SB_32310| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_32140| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_32110| Best HMM Match : PEGSRP (HMM E-Value=9.6) 95 5e-20 SB_31831| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_31818| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_31776| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_31757| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_31658| Best HMM Match : Arm (HMM E-Value=0.91) 95 5e-20 SB_31632| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_31490| Best HMM Match : Aa_trans (HMM E-Value=4.9e-31) 95 5e-20 SB_31476| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_31450| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_31401| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_31375| Best HMM Match : IQ (HMM E-Value=0.00076) 95 5e-20 SB_31367| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_31351| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_31291| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_31276| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_31227| Best HMM Match : RIO1 (HMM E-Value=0.13) 95 5e-20 SB_31127| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_31056| Best HMM Match : Virus_P-coat (HMM E-Value=6.4) 95 5e-20 SB_30978| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_30905| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_30849| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_30810| Best HMM Match : JmjC (HMM E-Value=0.0021) 95 5e-20 SB_30786| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_30644| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_30600| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_30578| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_30576| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_30457| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_30432| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_30415| Best HMM Match : M (HMM E-Value=6.5e-05) 95 5e-20 SB_30336| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_30192| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_29871| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_29660| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_29646| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_29445| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_29397| Best HMM Match : fn3 (HMM E-Value=0.038) 95 5e-20 SB_29341| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_29332| Best HMM Match : PAN (HMM E-Value=0.039) 95 5e-20 SB_29330| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_29217| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_29207| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_29178| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_29126| Best HMM Match : FUN14 (HMM E-Value=1.8) 95 5e-20 SB_29104| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_29084| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_29039| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_29037| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_29000| Best HMM Match : DUF551 (HMM E-Value=2.2) 95 5e-20 SB_28961| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_28940| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_28922| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_28866| Best HMM Match : PhdYeFM (HMM E-Value=8.3) 95 5e-20 SB_28825| Best HMM Match : COX8 (HMM E-Value=4.5) 95 5e-20 SB_28717| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_28646| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_28582| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_28530| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_28324| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_28283| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_28269| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_28216| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_28148| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_28058| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_28014| Best HMM Match : HOOK (HMM E-Value=1.8e-13) 95 5e-20 SB_27927| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_27874| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_27823| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_27779| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_27762| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_27619| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_27362| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_27165| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_27109| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_27108| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_27047| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_26735| Best HMM Match : rve (HMM E-Value=0.00066) 95 5e-20 SB_26597| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_26533| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_26393| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_26380| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_26309| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_25936| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_25922| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_25921| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_25891| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_25848| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_25680| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_25610| Best HMM Match : MAT_Alpha1 (HMM E-Value=7.2) 95 5e-20 SB_25598| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_25575| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_25523| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_25468| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_25442| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_25409| Best HMM Match : PSD1 (HMM E-Value=7.2) 95 5e-20 SB_25275| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_25265| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_25166| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_24859| Best HMM Match : HAP (HMM E-Value=6.4) 95 5e-20 SB_24822| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_24787| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_24727| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_24636| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_24611| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_24544| Best HMM Match : PSCyt1 (HMM E-Value=4.3) 95 5e-20 SB_24506| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_24484| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_24401| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_24337| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_24316| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_24181| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_24159| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_24066| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_23912| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_23850| Best HMM Match : SMP (HMM E-Value=4.9) 95 5e-20 SB_23569| Best HMM Match : PAN (HMM E-Value=0.0015) 95 5e-20 SB_23505| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_23442| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_23437| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 >SB_17237| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 78 Score = 109 bits (261), Expect = 2e-24 Identities = 52/55 (94%), Positives = 53/55 (96%) Frame = -2 Query: 503 YNLPFAIQAAQLLEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 339 + PFAIQAAQLLEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 HQAPFAIQAAQLLEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 62 >SB_30142| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 106 bits (255), Expect = 1e-23 Identities = 51/55 (92%), Positives = 52/55 (94%) Frame = -2 Query: 503 YNLPFAIQAAQLLEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 339 + PFAIQAAQL EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 HQAPFAIQAAQLWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 62 >SB_43825| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 106 bits (255), Expect = 1e-23 Identities = 51/55 (92%), Positives = 52/55 (94%) Frame = -2 Query: 503 YNLPFAIQAAQLLEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 339 + PFAIQAAQL EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 HQAPFAIQAAQLWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 62 >SB_3496| Best HMM Match : Herpes_UL49_5 (HMM E-Value=7.2) Length = 98 Score = 104 bits (249), Expect = 6e-23 Identities = 48/48 (100%), Positives = 48/48 (100%) Frame = +2 Query: 323 SRITIHWPSFYNVVTGKTLALPNLIALQHIPLSPAGVIAKRPAPIALP 466 SRITIHWPSFYNVVTGKTLALPNLIALQHIPLSPAGVIAKRPAPIALP Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALQHIPLSPAGVIAKRPAPIALP 49 >SB_36241| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 100 Score = 103 bits (247), Expect = 1e-22 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSNSCAA 480 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS+SCAA Sbjct: 54 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSHSCAA 100 >SB_12310| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 101 bits (242), Expect = 5e-22 Identities = 45/47 (95%), Positives = 45/47 (95%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSNSCAA 480 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS CAA Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQCAA 75 >SB_3970| Best HMM Match : Drf_FH1 (HMM E-Value=1.2) Length = 558 Score = 101 bits (242), Expect = 5e-22 Identities = 45/47 (95%), Positives = 45/47 (95%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSNSCAA 480 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS CAA Sbjct: 512 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQCAA 558 >SB_47433| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 49 Score = 99.5 bits (237), Expect = 2e-21 Identities = 48/49 (97%), Positives = 48/49 (97%) Frame = -2 Query: 479 AAQLLEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 333 AAQL EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 1 AAQLWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 49 >SB_43660| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 98.3 bits (234), Expect = 4e-21 Identities = 49/68 (72%), Positives = 51/68 (75%) Frame = +1 Query: 262 TTWTTIQPSRGGPVXXXXXXXXXXXXLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 441 TT TTI + G P+ LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 57 TTITTITTTTGDPLESTCRHASLA--LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 114 Query: 442 EARTDRPS 465 EARTDRPS Sbjct: 115 EARTDRPS 122 Score = 29.9 bits (64), Expect = 1.7 Identities = 11/15 (73%), Positives = 14/15 (93%) Frame = +3 Query: 459 PFQQLRSLNGEWQIV 503 P QQLRSLNGEW+++ Sbjct: 121 PSQQLRSLNGEWRLM 135 >SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 917 Score = 97.5 bits (232), Expect = 7e-21 Identities = 47/62 (75%), Positives = 49/62 (79%) Frame = +1 Query: 280 QPSRGGPVXXXXXXXXXXXXLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR 459 +PSRG P+ LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR Sbjct: 815 KPSRGDPLESTCRHASLA--LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR 872 Query: 460 PS 465 PS Sbjct: 873 PS 874 Score = 29.9 bits (64), Expect = 1.7 Identities = 11/15 (73%), Positives = 14/15 (93%) Frame = +3 Query: 459 PFQQLRSLNGEWQIV 503 P QQLRSLNGEW+++ Sbjct: 873 PSQQLRSLNGEWRLM 887 >SB_39201| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 97.1 bits (231), Expect = 1e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSN 468 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSN Sbjct: 20 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSN 62 >SB_47276| Best HMM Match : DUF851 (HMM E-Value=9.6) Length = 154 Score = 96.7 bits (230), Expect = 1e-20 Identities = 48/80 (60%), Positives = 56/80 (70%) Frame = +1 Query: 226 MGKNTMMRKASKTTWTTIQPSRGGPVXXXXXXXXXXXXLAVVLQRRDWENPGVTQLNRLA 405 M N+++ +K W ++ + G P+ LAVVLQRRDWENPGVTQLNRLA Sbjct: 38 MSVNSLISMVTKYVWLSMSVN-GDPLESTCRHASLA--LAVVLQRRDWENPGVTQLNRLA 94 Query: 406 AHPPFASWRNSEEARTDRPS 465 AHPPFASWRNSEEARTDRPS Sbjct: 95 AHPPFASWRNSEEARTDRPS 114 Score = 29.9 bits (64), Expect = 1.7 Identities = 11/15 (73%), Positives = 14/15 (93%) Frame = +3 Query: 459 PFQQLRSLNGEWQIV 503 P QQLRSLNGEW+++ Sbjct: 113 PSQQLRSLNGEWRLM 127 >SB_17747| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 96.3 bits (229), Expect = 2e-20 Identities = 54/108 (50%), Positives = 65/108 (60%), Gaps = 2/108 (1%) Frame = +1 Query: 148 IVGADNVGSQQMQQIRISLRGSSIVLMGKNTMMRKASKTTWTTIQPSRGGP--VXXXXXX 321 +VGA S+ + + + +S+ L +N +MR S + + R P Sbjct: 23 LVGAAGDASRSTDALSL-VPSTSVTLFIENRLMRSNSCSPGDPLVLERPPPRWSSNSPYS 81 Query: 322 XXXXXXLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 82 ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 129 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 128 PSQQLRSLNGEW 139 >SB_41613| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 49 Score = 95.9 bits (228), Expect = 2e-20 Identities = 47/49 (95%), Positives = 47/49 (95%) Frame = -2 Query: 479 AAQLLEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 333 AAQL EGRSVRASSLLRQLAKGGCAARRLSWVTP FSQSRRCKTTASEL Sbjct: 1 AAQLWEGRSVRASSLLRQLAKGGCAARRLSWVTPVFSQSRRCKTTASEL 49 >SB_35835| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 95.9 bits (228), Expect = 2e-20 Identities = 47/79 (59%), Positives = 56/79 (70%) Frame = +1 Query: 229 GKNTMMRKASKTTWTTIQPSRGGPVXXXXXXXXXXXXLAVVLQRRDWENPGVTQLNRLAA 408 G++ + ++ T+ T + + G P+ LAVVLQRRDWENPGVTQLNRLAA Sbjct: 4 GRHPYHSEQTRYTYQTTRSTVGDPLESTCRHASLA--LAVVLQRRDWENPGVTQLNRLAA 61 Query: 409 HPPFASWRNSEEARTDRPS 465 HPPFASWRNSEEARTDRPS Sbjct: 62 HPPFASWRNSEEARTDRPS 80 Score = 29.9 bits (64), Expect = 1.7 Identities = 11/15 (73%), Positives = 14/15 (93%) Frame = +3 Query: 459 PFQQLRSLNGEWQIV 503 P QQLRSLNGEW+++ Sbjct: 79 PSQQLRSLNGEWRLM 93 >SB_16265| Best HMM Match : Vicilin_N (HMM E-Value=3.3) Length = 199 Score = 95.5 bits (227), Expect = 3e-20 Identities = 48/74 (64%), Positives = 51/74 (68%), Gaps = 1/74 (1%) Frame = +1 Query: 247 RKASKTT-WTTIQPSRGGPVXXXXXXXXXXXXLAVVLQRRDWENPGVTQLNRLAAHPPFA 423 RK SK T +P++ LAVVLQRRDWENPGVTQLNRLAAHPPFA Sbjct: 77 RKTSKPQDMQTARPTQASRKTKTSKPESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFA 136 Query: 424 SWRNSEEARTDRPS 465 SWRNSEEARTDRPS Sbjct: 137 SWRNSEEARTDRPS 150 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 149 PSQQLRSLNGEW 160 >SB_32211| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 109 Score = 95.5 bits (227), Expect = 3e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = +2 Query: 338 HWPSFYNVVTGKTLALPNLIALQHIPLSPAGVIAKRPAPIALP 466 HWPSFYNVVTGKTLALPNLIALQHIPLSPAGVIAKRPAPIALP Sbjct: 62 HWPSFYNVVTGKTLALPNLIALQHIPLSPAGVIAKRPAPIALP 104 >SB_1214| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 95.5 bits (227), Expect = 3e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = +2 Query: 338 HWPSFYNVVTGKTLALPNLIALQHIPLSPAGVIAKRPAPIALP 466 HWPSFYNVVTGKTLALPNLIALQHIPLSPAGVIAKRPAPIALP Sbjct: 57 HWPSFYNVVTGKTLALPNLIALQHIPLSPAGVIAKRPAPIALP 99 >SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 35 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 76 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 75 PSQQLRSLNGEW 86 >SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 70 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 69 PSQQLRSLNGEW 80 >SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 62 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 103 Score = 29.9 bits (64), Expect = 1.7 Identities = 11/15 (73%), Positives = 14/15 (93%) Frame = +3 Query: 459 PFQQLRSLNGEWQIV 503 P QQLRSLNGEW+++ Sbjct: 102 PSQQLRSLNGEWRLM 116 >SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 44 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 85 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 84 PSQQLRSLNGEW 95 >SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 36 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 77 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 76 PSQQLRSLNGEW 87 >SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 62 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 103 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 102 PSQQLRSLNGEW 113 >SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 67 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 108 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 107 PSQQLRSLNGEW 118 >SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 38 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 79 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 78 PSQQLRSLNGEW 89 >SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 58 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 99 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 98 PSQQLRSLNGEW 109 >SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 161 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 70 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 111 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 110 PSQQLRSLNGEW 121 >SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 70 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 69 PSQQLRSLNGEW 80 >SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 46 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 87 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 86 PSQQLRSLNGEW 97 >SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 35 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 76 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 75 PSQQLRSLNGEW 86 >SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 25 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 66 Score = 29.9 bits (64), Expect = 1.7 Identities = 11/15 (73%), Positives = 14/15 (93%) Frame = +3 Query: 459 PFQQLRSLNGEWQIV 503 P QQLRSLNGEW+++ Sbjct: 65 PSQQLRSLNGEWRLM 79 >SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 50 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 91 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 90 PSQQLRSLNGEW 101 >SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 59 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 100 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 99 PSQQLRSLNGEW 110 >SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 53 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 94 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 93 PSQQLRSLNGEW 104 >SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 69 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 110 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 109 PSQQLRSLNGEW 120 >SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 57 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 98 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 97 PSQQLRSLNGEW 108 >SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 40 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 81 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 80 PSQQLRSLNGEW 91 >SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) Length = 297 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 216 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 257 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 256 PSQQLRSLNGEW 267 >SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 111 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 152 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 151 PSQQLRSLNGEW 162 >SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 49 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 90 Score = 29.9 bits (64), Expect = 1.7 Identities = 11/15 (73%), Positives = 14/15 (93%) Frame = +3 Query: 459 PFQQLRSLNGEWQIV 503 P QQLRSLNGEW+++ Sbjct: 89 PSQQLRSLNGEWRLM 103 >SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 28 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 69 Score = 29.9 bits (64), Expect = 1.7 Identities = 11/15 (73%), Positives = 14/15 (93%) Frame = +3 Query: 459 PFQQLRSLNGEWQIV 503 P QQLRSLNGEW+++ Sbjct: 68 PSQQLRSLNGEWRLM 82 >SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 70 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 69 PSQQLRSLNGEW 80 >SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 57 Score = 29.9 bits (64), Expect = 1.7 Identities = 11/15 (73%), Positives = 14/15 (93%) Frame = +3 Query: 459 PFQQLRSLNGEWQIV 503 P QQLRSLNGEW+++ Sbjct: 56 PSQQLRSLNGEWRLM 70 >SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 47 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 88 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 87 PSQQLRSLNGEW 98 >SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) Length = 472 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 381 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 422 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 421 PSQQLRSLNGEW 432 >SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 70 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 69 PSQQLRSLNGEW 80 >SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 70 Score = 29.9 bits (64), Expect = 1.7 Identities = 11/15 (73%), Positives = 14/15 (93%) Frame = +3 Query: 459 PFQQLRSLNGEWQIV 503 P QQLRSLNGEW+++ Sbjct: 69 PSQQLRSLNGEWRLM 83 >SB_57634| Best HMM Match : EGF_2 (HMM E-Value=0.0014) Length = 198 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 107 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 148 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 147 PSQQLRSLNGEW 158 >SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 70 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 69 PSQQLRSLNGEW 80 >SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 83 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 124 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 123 PSQQLRSLNGEW 134 >SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 39 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 80 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 79 PSQQLRSLNGEW 90 >SB_57287| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 8 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 49 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 48 PSQQLRSLNGEW 59 >SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 18 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 59 Score = 29.9 bits (64), Expect = 1.7 Identities = 11/15 (73%), Positives = 14/15 (93%) Frame = +3 Query: 459 PFQQLRSLNGEWQIV 503 P QQLRSLNGEW+++ Sbjct: 58 PSQQLRSLNGEWRLM 72 >SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) Length = 129 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 38 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 79 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 78 PSQQLRSLNGEW 89 >SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 70 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 69 PSQQLRSLNGEW 80 >SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 103 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 144 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 143 PSQQLRSLNGEW 154 >SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 45 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 86 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 85 PSQQLRSLNGEW 96 >SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 431 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 381 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 380 PSQQLRSLNGEW 391 >SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 80 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 121 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 120 PSQQLRSLNGEW 131 >SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 50 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 91 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 90 PSQQLRSLNGEW 101 >SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 70 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 69 PSQQLRSLNGEW 80 >SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 57 Score = 29.9 bits (64), Expect = 1.7 Identities = 11/15 (73%), Positives = 14/15 (93%) Frame = +3 Query: 459 PFQQLRSLNGEWQIV 503 P QQLRSLNGEW+++ Sbjct: 56 PSQQLRSLNGEWRLM 70 >SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 59 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 100 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 99 PSQQLRSLNGEW 110 >SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 43 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 84 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 83 PSQQLRSLNGEW 94 >SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 225 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 134 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 175 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 174 PSQQLRSLNGEW 185 >SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 70 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 69 PSQQLRSLNGEW 80 >SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 63 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 104 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 103 PSQQLRSLNGEW 114 >SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 39 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 80 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 79 PSQQLRSLNGEW 90 >SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) Length = 295 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 143 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 184 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 183 PSQQLRSLNGEW 194 >SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 57 Score = 29.9 bits (64), Expect = 1.7 Identities = 11/15 (73%), Positives = 14/15 (93%) Frame = +3 Query: 459 PFQQLRSLNGEWQIV 503 P QQLRSLNGEW+++ Sbjct: 56 PSQQLRSLNGEWRLM 70 >SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 60 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 101 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 100 PSQQLRSLNGEW 111 >SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 34 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 75 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 74 PSQQLRSLNGEW 85 >SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 73 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 114 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 113 PSQQLRSLNGEW 124 >SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 56 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 97 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 96 PSQQLRSLNGEW 107 >SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 69 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 110 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 109 PSQQLRSLNGEW 120 >SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 70 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 69 PSQQLRSLNGEW 80 >SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 539 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 256 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 297 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 296 PSQQLRSLNGEW 307 >SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 70 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 69 PSQQLRSLNGEW 80 >SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) Length = 195 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 114 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 155 Score = 29.9 bits (64), Expect = 1.7 Identities = 11/15 (73%), Positives = 14/15 (93%) Frame = +3 Query: 459 PFQQLRSLNGEWQIV 503 P QQLRSLNGEW+++ Sbjct: 154 PSQQLRSLNGEWRLM 168 >SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 50 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 91 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 90 PSQQLRSLNGEW 101 >SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 36 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 77 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 76 PSQQLRSLNGEW 87 >SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 37 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 78 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 77 PSQQLRSLNGEW 88 >SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) Length = 192 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 101 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 142 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 141 PSQQLRSLNGEW 152 >SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 205 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 114 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 155 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 154 PSQQLRSLNGEW 165 >SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 39 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 80 Score = 29.9 bits (64), Expect = 1.7 Identities = 11/15 (73%), Positives = 14/15 (93%) Frame = +3 Query: 459 PFQQLRSLNGEWQIV 503 P QQLRSLNGEW+++ Sbjct: 79 PSQQLRSLNGEWRLM 93 >SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 20 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 61 Score = 29.9 bits (64), Expect = 1.7 Identities = 11/15 (73%), Positives = 14/15 (93%) Frame = +3 Query: 459 PFQQLRSLNGEWQIV 503 P QQLRSLNGEW+++ Sbjct: 60 PSQQLRSLNGEWRLM 74 >SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 58 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 99 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 98 PSQQLRSLNGEW 109 >SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 37 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 78 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 77 PSQQLRSLNGEW 88 >SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 34 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 75 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 74 PSQQLRSLNGEW 85 >SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) Length = 349 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 11 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 52 Score = 29.9 bits (64), Expect = 1.7 Identities = 11/15 (73%), Positives = 14/15 (93%) Frame = +3 Query: 459 PFQQLRSLNGEWQIV 503 P QQLRSLNGEW+++ Sbjct: 51 PSQQLRSLNGEWRLM 65 >SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 19 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 60 Score = 29.9 bits (64), Expect = 1.7 Identities = 11/15 (73%), Positives = 14/15 (93%) Frame = +3 Query: 459 PFQQLRSLNGEWQIV 503 P QQLRSLNGEW+++ Sbjct: 59 PSQQLRSLNGEWRLM 73 >SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 487 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 396 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 437 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 436 PSQQLRSLNGEW 447 >SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 45 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 86 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 85 PSQQLRSLNGEW 96 >SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 54 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 95 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 94 PSQQLRSLNGEW 105 >SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 36 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 77 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 76 PSQQLRSLNGEW 87 >SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 70 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 69 PSQQLRSLNGEW 80 >SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 269 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 119 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 160 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 159 PSQQLRSLNGEW 170 >SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 55 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 96 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 95 PSQQLRSLNGEW 106 >SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 65 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 106 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 105 PSQQLRSLNGEW 116 >SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 68 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 109 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 108 PSQQLRSLNGEW 119 >SB_54473| Best HMM Match : DLIC (HMM E-Value=0) Length = 1401 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 414 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 455 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 454 PSQQLRSLNGEW 465 >SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 70 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 69 PSQQLRSLNGEW 80 >SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1) Length = 174 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 111 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 152 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 151 PSQQLRSLNGEW 162 >SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3) Length = 157 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 67 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 108 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 107 PSQQLRSLNGEW 118 >SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 56 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 97 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 96 PSQQLRSLNGEW 107 >SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) Length = 137 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 46 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 87 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 86 PSQQLRSLNGEW 97 >SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 252 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 161 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 202 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 201 PSQQLRSLNGEW 212 >SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 70 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 69 PSQQLRSLNGEW 80 >SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 65 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 106 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 105 PSQQLRSLNGEW 116 >SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 52 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 93 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 92 PSQQLRSLNGEW 103 >SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 88 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 129 Score = 29.9 bits (64), Expect = 1.7 Identities = 11/15 (73%), Positives = 14/15 (93%) Frame = +3 Query: 459 PFQQLRSLNGEWQIV 503 P QQLRSLNGEW+++ Sbjct: 128 PSQQLRSLNGEWRLM 142 >SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 37 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 78 Score = 29.9 bits (64), Expect = 1.7 Identities = 11/15 (73%), Positives = 14/15 (93%) Frame = +3 Query: 459 PFQQLRSLNGEWQIV 503 P QQLRSLNGEW+++ Sbjct: 77 PSQQLRSLNGEWRLM 91 >SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 63 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 104 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 103 PSQQLRSLNGEW 114 >SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 70 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 69 PSQQLRSLNGEW 80 >SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 70 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 69 PSQQLRSLNGEW 80 >SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 42 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 83 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 82 PSQQLRSLNGEW 93 >SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 70 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 69 PSQQLRSLNGEW 80 >SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 300 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 185 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 226 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 225 PSQQLRSLNGEW 236 >SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 34 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 75 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 74 PSQQLRSLNGEW 85 >SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 40 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 81 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 80 PSQQLRSLNGEW 91 >SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 54 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 95 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 94 PSQQLRSLNGEW 105 >SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) Length = 142 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 51 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 92 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 91 PSQQLRSLNGEW 102 >SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 70 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 69 PSQQLRSLNGEW 80 >SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 34 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 75 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 74 PSQQLRSLNGEW 85 >SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 35 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 76 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 75 PSQQLRSLNGEW 86 >SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 49 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 90 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 89 PSQQLRSLNGEW 100 >SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 39 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 80 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 79 PSQQLRSLNGEW 90 >SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 132 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 173 Score = 29.9 bits (64), Expect = 1.7 Identities = 11/15 (73%), Positives = 14/15 (93%) Frame = +3 Query: 459 PFQQLRSLNGEWQIV 503 P QQLRSLNGEW+++ Sbjct: 172 PSQQLRSLNGEWRLM 186 >SB_52260| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 70 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 69 PSQQLRSLNGEW 80 >SB_52253| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 41 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 82 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 81 PSQQLRSLNGEW 92 >SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 84 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 125 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 124 PSQQLRSLNGEW 135 >SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 22 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 63 Score = 29.9 bits (64), Expect = 1.7 Identities = 11/15 (73%), Positives = 14/15 (93%) Frame = +3 Query: 459 PFQQLRSLNGEWQIV 503 P QQLRSLNGEW+++ Sbjct: 62 PSQQLRSLNGEWRLM 76 >SB_52086| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 70 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 69 PSQQLRSLNGEW 80 >SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) Length = 234 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 153 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 194 Score = 29.9 bits (64), Expect = 1.7 Identities = 11/15 (73%), Positives = 14/15 (93%) Frame = +3 Query: 459 PFQQLRSLNGEWQIV 503 P QQLRSLNGEW+++ Sbjct: 193 PSQQLRSLNGEWRLM 207 >SB_51989| Best HMM Match : Extensin_2 (HMM E-Value=0.29) Length = 473 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 381 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 380 PSQQLRSLNGEW 391 >SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 57 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 98 Score = 29.9 bits (64), Expect = 1.7 Identities = 11/15 (73%), Positives = 14/15 (93%) Frame = +3 Query: 459 PFQQLRSLNGEWQIV 503 P QQLRSLNGEW+++ Sbjct: 97 PSQQLRSLNGEWRLM 111 >SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 21 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 62 Score = 29.9 bits (64), Expect = 1.7 Identities = 11/15 (73%), Positives = 14/15 (93%) Frame = +3 Query: 459 PFQQLRSLNGEWQIV 503 P QQLRSLNGEW+++ Sbjct: 61 PSQQLRSLNGEWRLM 75 >SB_51427| Best HMM Match : DUF855 (HMM E-Value=4) Length = 301 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 109 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 150 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 149 PSQQLRSLNGEW 160 >SB_51409| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 70 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 69 PSQQLRSLNGEW 80 >SB_51320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 70 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 69 PSQQLRSLNGEW 80 >SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 86 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 127 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 126 PSQQLRSLNGEW 137 >SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 36 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 77 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 76 PSQQLRSLNGEW 87 >SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 60 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 101 Score = 29.9 bits (64), Expect = 1.7 Identities = 11/15 (73%), Positives = 14/15 (93%) Frame = +3 Query: 459 PFQQLRSLNGEWQIV 503 P QQLRSLNGEW+++ Sbjct: 100 PSQQLRSLNGEWRLM 114 >SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) Length = 385 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 294 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 335 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 334 PSQQLRSLNGEW 345 >SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 57 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 98 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 97 PSQQLRSLNGEW 108 >SB_50493| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 58 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 99 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 98 PSQQLRSLNGEW 109 >SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 57 Score = 29.9 bits (64), Expect = 1.7 Identities = 11/15 (73%), Positives = 14/15 (93%) Frame = +3 Query: 459 PFQQLRSLNGEWQIV 503 P QQLRSLNGEW+++ Sbjct: 56 PSQQLRSLNGEWRLM 70 >SB_50417| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 36 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 77 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 76 PSQQLRSLNGEW 87 >SB_50270| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 857 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 411 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 452 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 451 PSQQLRSLNGEW 462 >SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 95 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 136 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 135 PSQQLRSLNGEW 146 >SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 51 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 92 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 91 PSQQLRSLNGEW 102 >SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 43 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 84 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 83 PSQQLRSLNGEW 94 >SB_49896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 184 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 93 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 134 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 133 PSQQLRSLNGEW 144 >SB_49839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 43 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 84 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 83 PSQQLRSLNGEW 94 >SB_49814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 302 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 211 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 252 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 251 PSQQLRSLNGEW 262 >SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 43 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 84 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 83 PSQQLRSLNGEW 94 >SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1615 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 213 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 254 Score = 29.9 bits (64), Expect = 1.7 Identities = 11/15 (73%), Positives = 14/15 (93%) Frame = +3 Query: 459 PFQQLRSLNGEWQIV 503 P QQLRSLNGEW+++ Sbjct: 253 PSQQLRSLNGEWRLM 267 >SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 88 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 33 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 74 Score = 29.9 bits (64), Expect = 1.7 Identities = 11/15 (73%), Positives = 14/15 (93%) Frame = +3 Query: 459 PFQQLRSLNGEWQIV 503 P QQLRSLNGEW+++ Sbjct: 73 PSQQLRSLNGEWRLM 87 >SB_49530| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 70 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 69 PSQQLRSLNGEW 80 >SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 48 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 89 Score = 29.9 bits (64), Expect = 1.7 Identities = 11/15 (73%), Positives = 14/15 (93%) Frame = +3 Query: 459 PFQQLRSLNGEWQIV 503 P QQLRSLNGEW+++ Sbjct: 88 PSQQLRSLNGEWRLM 102 >SB_49465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 38 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 79 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 78 PSQQLRSLNGEW 89 >SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 43 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 84 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 83 PSQQLRSLNGEW 94 >SB_49395| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 238 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 147 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 188 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 187 PSQQLRSLNGEW 198 >SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 45 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 86 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 85 PSQQLRSLNGEW 96 >SB_49211| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 35 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 76 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 75 PSQQLRSLNGEW 86 >SB_49150| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 55 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 96 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 95 PSQQLRSLNGEW 106 >SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 40 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 81 Score = 29.9 bits (64), Expect = 1.7 Identities = 11/15 (73%), Positives = 14/15 (93%) Frame = +3 Query: 459 PFQQLRSLNGEWQIV 503 P QQLRSLNGEW+++ Sbjct: 80 PSQQLRSLNGEWRLM 94 >SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 75 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 116 Score = 29.9 bits (64), Expect = 1.7 Identities = 11/15 (73%), Positives = 14/15 (93%) Frame = +3 Query: 459 PFQQLRSLNGEWQIV 503 P QQLRSLNGEW+++ Sbjct: 115 PSQQLRSLNGEWRLM 129 >SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) Length = 286 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 195 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 236 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 235 PSQQLRSLNGEW 246 >SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 53 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 94 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 93 PSQQLRSLNGEW 104 >SB_48522| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 32 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 73 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 72 PSQQLRSLNGEW 83 >SB_48514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 237 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 86 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 127 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 126 PSQQLRSLNGEW 137 >SB_48486| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 70 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 69 PSQQLRSLNGEW 80 >SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 22 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 63 Score = 29.9 bits (64), Expect = 1.7 Identities = 11/15 (73%), Positives = 14/15 (93%) Frame = +3 Query: 459 PFQQLRSLNGEWQIV 503 P QQLRSLNGEW+++ Sbjct: 62 PSQQLRSLNGEWRLM 76 >SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 49 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 90 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 89 PSQQLRSLNGEW 100 >SB_48129| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 70 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 69 PSQQLRSLNGEW 80 >SB_48100| Best HMM Match : Transformer (HMM E-Value=5.4) Length = 325 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 187 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 228 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 227 PSQQLRSLNGEW 238 >SB_48063| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 70 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 69 PSQQLRSLNGEW 80 >SB_48045| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 57 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 98 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 97 PSQQLRSLNGEW 108 >SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 67 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 108 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 107 PSQQLRSLNGEW 118 >SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 50 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 91 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 90 PSQQLRSLNGEW 101 >SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 57 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 98 Score = 29.9 bits (64), Expect = 1.7 Identities = 11/15 (73%), Positives = 14/15 (93%) Frame = +3 Query: 459 PFQQLRSLNGEWQIV 503 P QQLRSLNGEW+++ Sbjct: 97 PSQQLRSLNGEWRLM 111 >SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016) Length = 318 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 100 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 141 Score = 29.9 bits (64), Expect = 1.7 Identities = 11/15 (73%), Positives = 14/15 (93%) Frame = +3 Query: 459 PFQQLRSLNGEWQIV 503 P QQLRSLNGEW+++ Sbjct: 140 PSQQLRSLNGEWRLM 154 >SB_47536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 70 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 69 PSQQLRSLNGEW 80 >SB_47480| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 167 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 76 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 117 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 116 PSQQLRSLNGEW 127 >SB_47399| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 70 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 69 PSQQLRSLNGEW 80 >SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 96 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 137 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 136 PSQQLRSLNGEW 147 >SB_47213| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 103 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 40 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 81 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 80 PSQQLRSLNGEW 91 >SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 49 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 90 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 89 PSQQLRSLNGEW 100 >SB_46889| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 754 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 663 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 704 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 703 PSQQLRSLNGEW 714 >SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) Length = 139 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 48 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 89 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 88 PSQQLRSLNGEW 99 >SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 37 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 78 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 77 PSQQLRSLNGEW 88 >SB_46649| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 28 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 69 Score = 29.9 bits (64), Expect = 1.7 Identities = 11/15 (73%), Positives = 14/15 (93%) Frame = +3 Query: 459 PFQQLRSLNGEWQIV 503 P QQLRSLNGEW+++ Sbjct: 68 PSQQLRSLNGEWRLM 82 >SB_46589| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 562 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 187 Score = 30.3 bits (65), Expect = 1.3 Identities = 11/18 (61%), Positives = 15/18 (83%) Frame = +3 Query: 459 PFQQLRSLNGEWQIVSVI 512 P QQLRSLNGEW+++ + Sbjct: 186 PSQQLRSLNGEWRLMRAL 203 >SB_46529| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 38 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 79 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 78 PSQQLRSLNGEW 89 >SB_46517| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 70 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 69 PSQQLRSLNGEW 80 >SB_46424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 70 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 69 PSQQLRSLNGEW 80 >SB_46412| Best HMM Match : HEAT (HMM E-Value=8) Length = 140 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 59 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 100 Score = 29.9 bits (64), Expect = 1.7 Identities = 11/15 (73%), Positives = 14/15 (93%) Frame = +3 Query: 459 PFQQLRSLNGEWQIV 503 P QQLRSLNGEW+++ Sbjct: 99 PSQQLRSLNGEWRLM 113 >SB_46374| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 88 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 129 Score = 29.9 bits (64), Expect = 1.7 Identities = 11/15 (73%), Positives = 14/15 (93%) Frame = +3 Query: 459 PFQQLRSLNGEWQIV 503 P QQLRSLNGEW+++ Sbjct: 128 PSQQLRSLNGEWRLM 142 >SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 36 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 77 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 76 PSQQLRSLNGEW 87 >SB_46344| Best HMM Match : ig (HMM E-Value=0.0082) Length = 181 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 100 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 141 Score = 29.9 bits (64), Expect = 1.7 Identities = 11/15 (73%), Positives = 14/15 (93%) Frame = +3 Query: 459 PFQQLRSLNGEWQIV 503 P QQLRSLNGEW+++ Sbjct: 140 PSQQLRSLNGEWRLM 154 >SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) Length = 134 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 43 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 84 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 83 PSQQLRSLNGEW 94 >SB_46308| Best HMM Match : IMS (HMM E-Value=0) Length = 1245 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 1190 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 1231 Score = 56.4 bits (130), Expect = 2e-08 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = -2 Query: 464 EGRSVRASSLLRQLAKGGCAARRLSW 387 EGRSVRASSLLRQLAKGGCAARRLSW Sbjct: 414 EGRSVRASSLLRQLAKGGCAARRLSW 439 Score = 33.1 bits (72), Expect = 0.18 Identities = 11/12 (91%), Positives = 12/12 (100%) Frame = -3 Query: 493 HSPFRLRNCWKG 458 HSPFRLRNCW+G Sbjct: 404 HSPFRLRNCWEG 415 Score = 29.9 bits (64), Expect = 1.7 Identities = 11/15 (73%), Positives = 14/15 (93%) Frame = +3 Query: 459 PFQQLRSLNGEWQIV 503 P QQLRSLNGEW+++ Sbjct: 1230 PSQQLRSLNGEWRLM 1244 >SB_46303| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 42 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 83 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 82 PSQQLRSLNGEW 93 >SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 32 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 73 Score = 29.9 bits (64), Expect = 1.7 Identities = 11/15 (73%), Positives = 14/15 (93%) Frame = +3 Query: 459 PFQQLRSLNGEWQIV 503 P QQLRSLNGEW+++ Sbjct: 72 PSQQLRSLNGEWRLM 86 >SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 206 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 125 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 166 Score = 29.9 bits (64), Expect = 1.7 Identities = 11/15 (73%), Positives = 14/15 (93%) Frame = +3 Query: 459 PFQQLRSLNGEWQIV 503 P QQLRSLNGEW+++ Sbjct: 165 PSQQLRSLNGEWRLM 179 >SB_45887| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 70 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 69 PSQQLRSLNGEW 80 >SB_45813| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 56 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 97 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 96 PSQQLRSLNGEW 107 >SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 77 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 118 Score = 29.9 bits (64), Expect = 1.7 Identities = 11/15 (73%), Positives = 14/15 (93%) Frame = +3 Query: 459 PFQQLRSLNGEWQIV 503 P QQLRSLNGEW+++ Sbjct: 117 PSQQLRSLNGEWRLM 131 >SB_45524| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 50 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 91 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 90 PSQQLRSLNGEW 101 >SB_45424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 324 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 126 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 167 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 166 PSQQLRSLNGEW 177 >SB_45381| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 259 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 168 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 209 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 208 PSQQLRSLNGEW 219 >SB_45291| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 31 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 72 Score = 29.9 bits (64), Expect = 1.7 Identities = 11/15 (73%), Positives = 14/15 (93%) Frame = +3 Query: 459 PFQQLRSLNGEWQIV 503 P QQLRSLNGEW+++ Sbjct: 71 PSQQLRSLNGEWRLM 85 >SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 80 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 121 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 120 PSQQLRSLNGEW 131 >SB_44920| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 30 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 71 >SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 45 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 86 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 85 PSQQLRSLNGEW 96 >SB_44894| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 57 Score = 29.9 bits (64), Expect = 1.7 Identities = 11/15 (73%), Positives = 14/15 (93%) Frame = +3 Query: 459 PFQQLRSLNGEWQIV 503 P QQLRSLNGEW+++ Sbjct: 56 PSQQLRSLNGEWRLM 70 >SB_44806| Best HMM Match : Hist_deacetyl (HMM E-Value=0) Length = 496 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 75 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 116 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 115 PSQQLRSLNGEW 126 >SB_44800| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 70 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 69 PSQQLRSLNGEW 80 >SB_44789| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 70 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 69 PSQQLRSLNGEW 80 >SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) Length = 1016 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 925 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 966 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 965 PSQQLRSLNGEW 976 >SB_44606| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 89 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 34 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 75 Score = 29.9 bits (64), Expect = 1.7 Identities = 11/15 (73%), Positives = 14/15 (93%) Frame = +3 Query: 459 PFQQLRSLNGEWQIV 503 P QQLRSLNGEW+++ Sbjct: 74 PSQQLRSLNGEWRLM 88 >SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 36 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 77 Score = 29.9 bits (64), Expect = 1.7 Identities = 11/15 (73%), Positives = 14/15 (93%) Frame = +3 Query: 459 PFQQLRSLNGEWQIV 503 P QQLRSLNGEW+++ Sbjct: 76 PSQQLRSLNGEWRLM 90 >SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 46 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 87 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 86 PSQQLRSLNGEW 97 >SB_44466| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 70 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 69 PSQQLRSLNGEW 80 >SB_44411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 70 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 69 PSQQLRSLNGEW 80 >SB_44401| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 36 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 77 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 76 PSQQLRSLNGEW 87 >SB_44392| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 70 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 69 PSQQLRSLNGEW 80 >SB_44358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 96 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 137 Score = 29.9 bits (64), Expect = 1.7 Identities = 11/15 (73%), Positives = 14/15 (93%) Frame = +3 Query: 459 PFQQLRSLNGEWQIV 503 P QQLRSLNGEW+++ Sbjct: 136 PSQQLRSLNGEWRLM 150 >SB_44259| Best HMM Match : MORN (HMM E-Value=3.7) Length = 718 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 353 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 394 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 393 PSQQLRSLNGEW 404 >SB_44076| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 83 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 124 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 123 PSQQLRSLNGEW 134 >SB_44013| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 70 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 69 PSQQLRSLNGEW 80 >SB_43970| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 65 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 106 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 105 PSQQLRSLNGEW 116 >SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) Length = 166 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 75 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 116 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 115 PSQQLRSLNGEW 126 >SB_43909| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 70 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 69 PSQQLRSLNGEW 80 >SB_43701| Best HMM Match : ubiquitin (HMM E-Value=0.003) Length = 227 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 8 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 49 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 48 PSQQLRSLNGEW 59 >SB_43671| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 61 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 102 Score = 29.9 bits (64), Expect = 1.7 Identities = 11/15 (73%), Positives = 14/15 (93%) Frame = +3 Query: 459 PFQQLRSLNGEWQIV 503 P QQLRSLNGEW+++ Sbjct: 101 PSQQLRSLNGEWRLM 115 >SB_43630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 84 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 125 Score = 29.9 bits (64), Expect = 1.7 Identities = 11/15 (73%), Positives = 14/15 (93%) Frame = +3 Query: 459 PFQQLRSLNGEWQIV 503 P QQLRSLNGEW+++ Sbjct: 124 PSQQLRSLNGEWRLM 138 >SB_43618| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 70 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 69 PSQQLRSLNGEW 80 >SB_43569| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 40 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 81 Score = 29.9 bits (64), Expect = 1.7 Identities = 11/15 (73%), Positives = 14/15 (93%) Frame = +3 Query: 459 PFQQLRSLNGEWQIV 503 P QQLRSLNGEW+++ Sbjct: 80 PSQQLRSLNGEWRLM 94 >SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 217 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 126 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 167 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 166 PSQQLRSLNGEW 177 >SB_43145| Best HMM Match : PEGSRP (HMM E-Value=7.2) Length = 165 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 84 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 125 Score = 29.9 bits (64), Expect = 1.7 Identities = 11/15 (73%), Positives = 14/15 (93%) Frame = +3 Query: 459 PFQQLRSLNGEWQIV 503 P QQLRSLNGEW+++ Sbjct: 124 PSQQLRSLNGEWRLM 138 >SB_43138| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.3e-14) Length = 1709 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 1473 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 1514 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 1513 PSQQLRSLNGEW 1524 >SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 97 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 138 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 137 PSQQLRSLNGEW 148 >SB_42990| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 57 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 98 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 97 PSQQLRSLNGEW 108 >SB_42937| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 54 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 95 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 94 PSQQLRSLNGEW 105 >SB_42936| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 104 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 145 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 144 PSQQLRSLNGEW 155 >SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 47 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 88 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 459 PFQQLRSLNGEW 494 P QQLRSLNGEW Sbjct: 87 PSQQLRSLNGEW 98 >SB_42831| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 94.7 bits (225), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 465 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS Sbjct: 84 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 125 Score = 29.9 bits (64), Expect = 1.7 Identities = 11/15 (73%), Positives = 14/15 (93%) Frame = +3 Query: 459 PFQQLRSLNGEWQIV 503 P QQLRSLNGEW+++ Sbjct: 124 PSQQLRSLNGEWRLM 138 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,773,126 Number of Sequences: 59808 Number of extensions: 447348 Number of successful extensions: 9222 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 5090 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9163 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1475788250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -