BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0298 (712 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z81048-9|CAI79126.1| 560|Caenorhabditis elegans Hypothetical pr... 28 5.7 Z81048-8|CAB51463.1| 602|Caenorhabditis elegans Hypothetical pr... 28 5.7 AF039570-1|AAC00000.1| 602|Caenorhabditis elegans aryl hydrocar... 28 5.7 >Z81048-9|CAI79126.1| 560|Caenorhabditis elegans Hypothetical protein C41G7.5b protein. Length = 560 Score = 28.3 bits (60), Expect = 5.7 Identities = 14/33 (42%), Positives = 18/33 (54%), Gaps = 1/33 (3%) Frame = -3 Query: 386 PAGYRP-ALSLVFTHPALDSVCRYQTPSSHINL 291 P G+ P A LV HP + Y TPS+H +L Sbjct: 506 PHGFTPDAQKLVPPHPQMSHFTEYPTPSTHHDL 538 >Z81048-8|CAB51463.1| 602|Caenorhabditis elegans Hypothetical protein C41G7.5a protein. Length = 602 Score = 28.3 bits (60), Expect = 5.7 Identities = 14/33 (42%), Positives = 18/33 (54%), Gaps = 1/33 (3%) Frame = -3 Query: 386 PAGYRP-ALSLVFTHPALDSVCRYQTPSSHINL 291 P G+ P A LV HP + Y TPS+H +L Sbjct: 548 PHGFTPDAQKLVPPHPQMSHFTEYPTPSTHHDL 580 >AF039570-1|AAC00000.1| 602|Caenorhabditis elegans aryl hydrocarbon receptor orthologAHR-1 protein. Length = 602 Score = 28.3 bits (60), Expect = 5.7 Identities = 14/33 (42%), Positives = 18/33 (54%), Gaps = 1/33 (3%) Frame = -3 Query: 386 PAGYRP-ALSLVFTHPALDSVCRYQTPSSHINL 291 P G+ P A LV HP + Y TPS+H +L Sbjct: 548 PHGFTPDAQKLVPPHPQMSHFTEYPTPSTHHDL 580 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,211,645 Number of Sequences: 27780 Number of extensions: 368374 Number of successful extensions: 813 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 787 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 813 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1655655746 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -