BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0296 (650 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_07_0181 - 28225396-28225587,28226009-28226068,28226150-282264... 28 5.6 05_04_0385 - 20817073-20817321,20817474-20817660,20817851-20817918 27 9.8 >05_07_0181 - 28225396-28225587,28226009-28226068,28226150-28226416, 28227167-28227232,28228164-28228963,28229565-28229673, 28230391-28232097 Length = 1066 Score = 28.3 bits (60), Expect = 5.6 Identities = 12/29 (41%), Positives = 19/29 (65%) Frame = +1 Query: 478 KKV*SRRGLKVRHPVHSYVAMHRCSNRSD 564 +KV + + VR PVH++ A HR N+S+ Sbjct: 458 QKVGEQGSIAVRRPVHTFWANHRGGNQSE 486 >05_04_0385 - 20817073-20817321,20817474-20817660,20817851-20817918 Length = 167 Score = 27.5 bits (58), Expect = 9.8 Identities = 15/37 (40%), Positives = 23/37 (62%) Frame = -2 Query: 520 QGVLPLGHDDFKLFYSKKHLVV*LVAIDLVSILILPL 410 +G+ +G KLF +KKH + LV + L +LILP+ Sbjct: 105 KGLNNIGELSIKLFETKKHDLYDLVYLLLKLVLILPV 141 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,432,321 Number of Sequences: 37544 Number of extensions: 223404 Number of successful extensions: 456 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 455 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 456 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1620349964 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -