BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0296 (650 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667188-1|ABG75740.1| 383|Apis mellifera histamine-gated chlor... 23 3.4 DQ325081-1|ABD14095.1| 186|Apis mellifera complementary sex det... 22 4.5 DQ325080-1|ABD14094.1| 184|Apis mellifera complementary sex det... 22 4.5 DQ325079-1|ABD14093.1| 184|Apis mellifera complementary sex det... 22 4.5 DQ325078-1|ABD14092.1| 184|Apis mellifera complementary sex det... 22 4.5 DQ232888-1|ABB36783.1| 499|Apis mellifera cytochrome P450 monoo... 22 4.5 >DQ667188-1|ABG75740.1| 383|Apis mellifera histamine-gated chloride channel protein. Length = 383 Score = 22.6 bits (46), Expect = 3.4 Identities = 10/28 (35%), Positives = 13/28 (46%) Frame = +3 Query: 393 TSLLTFRGRIRIDTRSIATNYTTKCFLE 476 T L I + I+ NYTT C +E Sbjct: 167 TDPLVVNPEIELPQLDISNNYTTDCTIE 194 >DQ325081-1|ABD14095.1| 186|Apis mellifera complementary sex determiner protein. Length = 186 Score = 22.2 bits (45), Expect = 4.5 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = +2 Query: 419 NQN*YKINCYQLYYQM 466 N N Y NC +LYY + Sbjct: 101 NNNNYNNNCKKLYYNI 116 >DQ325080-1|ABD14094.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 22.2 bits (45), Expect = 4.5 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = +2 Query: 419 NQN*YKINCYQLYYQM 466 N N Y NC +LYY + Sbjct: 101 NNNNYNNNCKKLYYNI 116 >DQ325079-1|ABD14093.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 22.2 bits (45), Expect = 4.5 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = +2 Query: 419 NQN*YKINCYQLYYQM 466 N N Y NC +LYY + Sbjct: 101 NNNNYNNNCKKLYYNI 116 >DQ325078-1|ABD14092.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 22.2 bits (45), Expect = 4.5 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = +2 Query: 419 NQN*YKINCYQLYYQM 466 N N Y NC +LYY + Sbjct: 101 NNNNYNNNCKKLYYNI 116 >DQ232888-1|ABB36783.1| 499|Apis mellifera cytochrome P450 monooxygenase protein. Length = 499 Score = 22.2 bits (45), Expect = 4.5 Identities = 6/32 (18%), Positives = 20/32 (62%) Frame = -3 Query: 600 YFIHISLKKWMPIRAI*TPVHCYIRMHRVSYL 505 + +++ +++W P+R+ +P+ ++ + YL Sbjct: 119 HLLNLEVERWRPLRSRLSPIFTSGKLKEMFYL 150 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 148,638 Number of Sequences: 438 Number of extensions: 2610 Number of successful extensions: 8 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19682733 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -