BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0287 (704 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_53102| Best HMM Match : CUB (HMM E-Value=3.3e-40) 29 4.9 >SB_53102| Best HMM Match : CUB (HMM E-Value=3.3e-40) Length = 644 Score = 28.7 bits (61), Expect = 4.9 Identities = 16/48 (33%), Positives = 23/48 (47%) Frame = +3 Query: 417 QPAEFLAGLLSGSLFRTGSKFIREAATLELLVSLGSARVAASKSHPSW 560 Q E AG + GSL R G+ + A +L L VS + S+P + Sbjct: 148 QHLEMAAGNVQGSLARPGTATYKNAPSLRLCVSASDSHRCGPGSNPGF 195 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,937,359 Number of Sequences: 59808 Number of extensions: 422336 Number of successful extensions: 916 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 831 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 914 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1853669818 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -