BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0287 (704 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AE013599-2571|AAF57784.3| 1302|Drosophila melanogaster CG5058-PC... 29 8.1 AE013599-2570|AAM68467.2| 1333|Drosophila melanogaster CG5058-PD... 29 8.1 >AE013599-2571|AAF57784.3| 1302|Drosophila melanogaster CG5058-PC, isoform C protein. Length = 1302 Score = 28.7 bits (61), Expect = 8.1 Identities = 16/41 (39%), Positives = 22/41 (53%) Frame = +3 Query: 444 LSGSLFRTGSKFIREAATLELLVSLGSARVAASKSHPSWLS 566 +SGS +GS R ATLE+ + G ++ SHPS S Sbjct: 587 VSGS--ESGSPGARTTATLEMYATTGGTQIYLQTSHPSTAS 625 >AE013599-2570|AAM68467.2| 1333|Drosophila melanogaster CG5058-PD, isoform D protein. Length = 1333 Score = 28.7 bits (61), Expect = 8.1 Identities = 16/41 (39%), Positives = 22/41 (53%) Frame = +3 Query: 444 LSGSLFRTGSKFIREAATLELLVSLGSARVAASKSHPSWLS 566 +SGS +GS R ATLE+ + G ++ SHPS S Sbjct: 587 VSGS--ESGSPGARTTATLEMYATTGGTQIYLQTSHPSTAS 625 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 30,029,669 Number of Sequences: 53049 Number of extensions: 615664 Number of successful extensions: 1684 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1575 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1652 length of database: 24,988,368 effective HSP length: 83 effective length of database: 20,585,301 effective search space used: 3108380451 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -