BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0280 (675 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY736135-1|AAU84701.1| 253|Apis mellifera take-out-like carrier... 37 2e-04 AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protei... 21 8.1 >AY736135-1|AAU84701.1| 253|Apis mellifera take-out-like carrier protein JHBP-1 protein. Length = 253 Score = 37.1 bits (82), Expect = 2e-04 Identities = 22/80 (27%), Positives = 35/80 (43%), Gaps = 1/80 (1%) Frame = +1 Query: 268 EPIVIDELSIALGAGPDGYRATFKDIHASGAS-NMTITNVRSDLETHQFQLTLYGPHISA 444 EP+ +D + I G R +K+I G + N+ I N D + Y P + Sbjct: 68 EPLAVDSVKIGESQGSVTLRQEYKNIKLYGLTKNLEIKNYNIDWDKCILSSESYNPQVDF 127 Query: 445 RARYRSSGVLLLVRASGGGE 504 A Y+ G +LL+ G G+ Sbjct: 128 VADYKIEGKVLLLPVRGAGK 147 >AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protein kinase foraging protein. Length = 678 Score = 21.4 bits (43), Expect = 8.1 Identities = 6/14 (42%), Positives = 11/14 (78%) Frame = -1 Query: 273 GLSLFDAISGAPPF 232 G+ +F+ ++G PPF Sbjct: 552 GVLMFELLTGTPPF 565 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 181,046 Number of Sequences: 438 Number of extensions: 3688 Number of successful extensions: 7 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20464920 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -