BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0278 (674 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_38437| Best HMM Match : VWA (HMM E-Value=0) 33 0.16 SB_42286| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.49 >SB_38437| Best HMM Match : VWA (HMM E-Value=0) Length = 3445 Score = 33.5 bits (73), Expect = 0.16 Identities = 17/38 (44%), Positives = 22/38 (57%) Frame = -3 Query: 501 KKLWTPTKRPFWRPQLPNGMVASMIGSIVWKNVSNFAE 388 K L TPT+RP +P+L G + GSI +N NF E Sbjct: 1229 KTLPTPTRRPVCKPKLDLGFLIDGSGSINHRNGRNFVE 1266 >SB_42286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1820 Score = 31.9 bits (69), Expect = 0.49 Identities = 21/79 (26%), Positives = 38/79 (48%), Gaps = 2/79 (2%) Frame = +3 Query: 153 FFLSFEDKNADAILKLSSPLDR-RFYLFIFYYIDGGRTRSPSAVKWLPEPIRGRH*KFRE 329 F S+ D+N ++LK P D+ R F+ Y G + + + +RG + ++ Sbjct: 1247 FLNSYHDQNRYSVLKKGEPTDKGRRMKFVVYETKDGSNVTTAYNRLKENLVRGASDELKQ 1306 Query: 330 L-TK*HNITI*KCIYCFSK 383 L K +NI + YCF++ Sbjct: 1307 LKLKKNNIGVTSAEYCFAE 1325 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,777,490 Number of Sequences: 59808 Number of extensions: 463509 Number of successful extensions: 1220 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1158 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1220 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1733301648 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -