BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0278 (674 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U49974-1|AAC52011.1| 351|Homo sapiens mariner transposase protein. 46 1e-04 BC150212-1|AAI50213.1| 1479|Homo sapiens mannose receptor, C typ... 31 2.8 BC146647-1|AAI46648.1| 1479|Homo sapiens mannose receptor, C typ... 31 2.8 AF134838-1|AAD30280.1| 1479|Homo sapiens endocytic receptor Endo... 31 2.8 AF107292-1|AAF14192.1| 1479|Homo sapiens urokinase receptor-asso... 31 2.8 AB014609-1|BAA31684.2| 1484|Homo sapiens KIAA0709 protein protein. 31 2.8 X97233-1|CAA65872.1| 382|Homo sapiens NK receptor protein. 31 4.9 X97232-1|CAA65871.1| 287|Homo sapiens NK receptor protein. 31 4.9 U73396-1|AAC51148.1| 382|Homo sapiens NK-receptor protein. 31 4.9 DQ371595-1|ABD38579.1| 382|Homo sapiens killer Ig receptor prot... 31 4.9 DQ227845-1|ABB51563.1| 382|Homo sapiens KIR3DS1 protein. 31 4.9 DQ227844-1|ABB51562.1| 382|Homo sapiens KIR3DS1 protein. 31 4.9 BC105679-1|AAI05680.1| 382|Homo sapiens killer cell immunoglobu... 31 4.9 BC098288-1|AAH98288.1| 382|Homo sapiens killer cell immunoglobu... 31 4.9 BC098107-1|AAH98107.1| 275|Homo sapiens KIR3DS1 protein protein. 31 4.9 AY760058-1|AAX89529.1| 382|Homo sapiens KIR3DS1 protein. 31 4.9 AY760057-1|AAX89528.1| 382|Homo sapiens KIR3DS1 protein. 31 4.9 AY760056-1|AAX89527.1| 382|Homo sapiens KIR3DS1 protein. 31 4.9 AY760055-1|AAX89526.1| 382|Homo sapiens KIR3DS1 protein. 31 4.9 AY760033-1|AAV32446.1| 382|Homo sapiens KIR3DS1 protein. 31 4.9 AY760032-1|AAV32445.1| 382|Homo sapiens KIR3DS1 protein. 31 4.9 AL133414-12|CAC40713.1| 287|Homo sapiens 1060P11.5.2 (killer ce... 31 4.9 AL133414-11|CAC40712.1| 382|Homo sapiens 1060P11.5.1 (killer ce... 31 4.9 AJ417558-1|CAD10382.2| 365|Homo sapiens killer cell immunoglobu... 31 4.9 AF022044-1|AAB95317.1| 382|Homo sapiens natural killer cell rec... 31 4.9 AF001883-1|AAB94765.1| 163|Homo sapiens NK-receptor protein. 31 4.9 >U49974-1|AAC52011.1| 351|Homo sapiens mariner transposase protein. Length = 351 Score = 46.0 bits (104), Expect = 1e-04 Identities = 20/60 (33%), Positives = 32/60 (53%) Frame = -3 Query: 672 HHAHGGSYPRAQTKRFFRARKHRIIRPSTDSPDLSPNDFYTFPKIKNKFREQRFSHLKKL 493 HH + ++ QT+ R + IIR SPDL+P+DF+ FP +K + FS + + Sbjct: 252 HHDNAPAHSSHQTRAILREFRWEIIRHPPYSPDLAPSDFFLFPNLKKSLKGTHFSSVNNV 311 Score = 36.3 bits (80), Expect = 0.099 Identities = 20/69 (28%), Positives = 29/69 (42%) Frame = -2 Query: 580 PRLKP**FLYFP*NKE*IS*TEIFSPEEAVDAYKTAILETPTSEWNGCFNDWFHRMEKCF 401 P L P F FP K+ + T S T + + N W+HR++KC Sbjct: 283 PDLAPSDFFLFPNLKKSLKGTHFSSVNNVKKTALTWLNSQDPQFFRDGLNGWYHRLQKCL 342 Query: 400 KFRGEYLEK 374 + G Y+EK Sbjct: 343 ELDGAYVEK 351 >BC150212-1|AAI50213.1| 1479|Homo sapiens mannose receptor, C type 2 protein. Length = 1479 Score = 31.5 bits (68), Expect = 2.8 Identities = 10/27 (37%), Positives = 17/27 (62%) Frame = -2 Query: 466 ETPTSEWNGCFNDWFHRMEKCFKFRGE 386 + PT+ GC +DW + KCF+ +G+ Sbjct: 963 DLPTTALGGCPSDWIQFLNKCFQVQGQ 989 >BC146647-1|AAI46648.1| 1479|Homo sapiens mannose receptor, C type 2 protein. Length = 1479 Score = 31.5 bits (68), Expect = 2.8 Identities = 10/27 (37%), Positives = 17/27 (62%) Frame = -2 Query: 466 ETPTSEWNGCFNDWFHRMEKCFKFRGE 386 + PT+ GC +DW + KCF+ +G+ Sbjct: 963 DLPTTALGGCPSDWIQFLNKCFQVQGQ 989 >AF134838-1|AAD30280.1| 1479|Homo sapiens endocytic receptor Endo180 protein. Length = 1479 Score = 31.5 bits (68), Expect = 2.8 Identities = 10/27 (37%), Positives = 17/27 (62%) Frame = -2 Query: 466 ETPTSEWNGCFNDWFHRMEKCFKFRGE 386 + PT+ GC +DW + KCF+ +G+ Sbjct: 963 DLPTTALGGCPSDWIQFLNKCFQVQGQ 989 >AF107292-1|AAF14192.1| 1479|Homo sapiens urokinase receptor-associated protein uPARAP protein. Length = 1479 Score = 31.5 bits (68), Expect = 2.8 Identities = 10/27 (37%), Positives = 17/27 (62%) Frame = -2 Query: 466 ETPTSEWNGCFNDWFHRMEKCFKFRGE 386 + PT+ GC +DW + KCF+ +G+ Sbjct: 963 DLPTTALGGCPSDWIQFLNKCFQVQGQ 989 >AB014609-1|BAA31684.2| 1484|Homo sapiens KIAA0709 protein protein. Length = 1484 Score = 31.5 bits (68), Expect = 2.8 Identities = 10/27 (37%), Positives = 17/27 (62%) Frame = -2 Query: 466 ETPTSEWNGCFNDWFHRMEKCFKFRGE 386 + PT+ GC +DW + KCF+ +G+ Sbjct: 968 DLPTTALGGCPSDWIQFLNKCFQVQGQ 994 >X97233-1|CAA65872.1| 382|Homo sapiens NK receptor protein. Length = 382 Score = 30.7 bits (66), Expect = 4.9 Identities = 9/19 (47%), Positives = 14/19 (73%) Frame = +2 Query: 224 LFIYFLLHRWGTNSQPICC 280 + ++FLLHRW +N + CC Sbjct: 354 ILLFFLLHRWCSNKKKCCC 372 >X97232-1|CAA65871.1| 287|Homo sapiens NK receptor protein. Length = 287 Score = 30.7 bits (66), Expect = 4.9 Identities = 9/19 (47%), Positives = 14/19 (73%) Frame = +2 Query: 224 LFIYFLLHRWGTNSQPICC 280 + ++FLLHRW +N + CC Sbjct: 259 ILLFFLLHRWCSNKKKCCC 277 >U73396-1|AAC51148.1| 382|Homo sapiens NK-receptor protein. Length = 382 Score = 30.7 bits (66), Expect = 4.9 Identities = 9/19 (47%), Positives = 14/19 (73%) Frame = +2 Query: 224 LFIYFLLHRWGTNSQPICC 280 + ++FLLHRW +N + CC Sbjct: 354 ILLFFLLHRWCSNKKKCCC 372 >DQ371595-1|ABD38579.1| 382|Homo sapiens killer Ig receptor protein. Length = 382 Score = 30.7 bits (66), Expect = 4.9 Identities = 9/19 (47%), Positives = 14/19 (73%) Frame = +2 Query: 224 LFIYFLLHRWGTNSQPICC 280 + ++FLLHRW +N + CC Sbjct: 354 ILLFFLLHRWCSNKKKCCC 372 >DQ227845-1|ABB51563.1| 382|Homo sapiens KIR3DS1 protein. Length = 382 Score = 30.7 bits (66), Expect = 4.9 Identities = 9/19 (47%), Positives = 14/19 (73%) Frame = +2 Query: 224 LFIYFLLHRWGTNSQPICC 280 + ++FLLHRW +N + CC Sbjct: 354 ILLFFLLHRWCSNKKKCCC 372 >DQ227844-1|ABB51562.1| 382|Homo sapiens KIR3DS1 protein. Length = 382 Score = 30.7 bits (66), Expect = 4.9 Identities = 9/19 (47%), Positives = 14/19 (73%) Frame = +2 Query: 224 LFIYFLLHRWGTNSQPICC 280 + ++FLLHRW +N + CC Sbjct: 354 ILLFFLLHRWCSNKKKCCC 372 >BC105679-1|AAI05680.1| 382|Homo sapiens killer cell immunoglobulin-like receptor, three domains, short cytoplasmic tail protein. Length = 382 Score = 30.7 bits (66), Expect = 4.9 Identities = 9/19 (47%), Positives = 14/19 (73%) Frame = +2 Query: 224 LFIYFLLHRWGTNSQPICC 280 + ++FLLHRW +N + CC Sbjct: 354 ILLFFLLHRWCSNKKKCCC 372 >BC098288-1|AAH98288.1| 382|Homo sapiens killer cell immunoglobulin-like receptor, three domains, short cytoplasmic tail protein. Length = 382 Score = 30.7 bits (66), Expect = 4.9 Identities = 9/19 (47%), Positives = 14/19 (73%) Frame = +2 Query: 224 LFIYFLLHRWGTNSQPICC 280 + ++FLLHRW +N + CC Sbjct: 354 ILLFFLLHRWCSNKKKCCC 372 >BC098107-1|AAH98107.1| 275|Homo sapiens KIR3DS1 protein protein. Length = 275 Score = 30.7 bits (66), Expect = 4.9 Identities = 9/19 (47%), Positives = 14/19 (73%) Frame = +2 Query: 224 LFIYFLLHRWGTNSQPICC 280 + ++FLLHRW +N + CC Sbjct: 247 ILLFFLLHRWCSNKKKCCC 265 >AY760058-1|AAX89529.1| 382|Homo sapiens KIR3DS1 protein. Length = 382 Score = 30.7 bits (66), Expect = 4.9 Identities = 9/19 (47%), Positives = 14/19 (73%) Frame = +2 Query: 224 LFIYFLLHRWGTNSQPICC 280 + ++FLLHRW +N + CC Sbjct: 354 ILLFFLLHRWCSNKKKCCC 372 >AY760057-1|AAX89528.1| 382|Homo sapiens KIR3DS1 protein. Length = 382 Score = 30.7 bits (66), Expect = 4.9 Identities = 9/19 (47%), Positives = 14/19 (73%) Frame = +2 Query: 224 LFIYFLLHRWGTNSQPICC 280 + ++FLLHRW +N + CC Sbjct: 354 ILLFFLLHRWCSNKKKCCC 372 >AY760056-1|AAX89527.1| 382|Homo sapiens KIR3DS1 protein. Length = 382 Score = 30.7 bits (66), Expect = 4.9 Identities = 9/19 (47%), Positives = 14/19 (73%) Frame = +2 Query: 224 LFIYFLLHRWGTNSQPICC 280 + ++FLLHRW +N + CC Sbjct: 354 ILLFFLLHRWCSNKKKCCC 372 >AY760055-1|AAX89526.1| 382|Homo sapiens KIR3DS1 protein. Length = 382 Score = 30.7 bits (66), Expect = 4.9 Identities = 9/19 (47%), Positives = 14/19 (73%) Frame = +2 Query: 224 LFIYFLLHRWGTNSQPICC 280 + ++FLLHRW +N + CC Sbjct: 354 ILLFFLLHRWCSNKKKCCC 372 >AY760033-1|AAV32446.1| 382|Homo sapiens KIR3DS1 protein. Length = 382 Score = 30.7 bits (66), Expect = 4.9 Identities = 9/19 (47%), Positives = 14/19 (73%) Frame = +2 Query: 224 LFIYFLLHRWGTNSQPICC 280 + ++FLLHRW +N + CC Sbjct: 354 ILLFFLLHRWCSNKKKCCC 372 >AY760032-1|AAV32445.1| 382|Homo sapiens KIR3DS1 protein. Length = 382 Score = 30.7 bits (66), Expect = 4.9 Identities = 9/19 (47%), Positives = 14/19 (73%) Frame = +2 Query: 224 LFIYFLLHRWGTNSQPICC 280 + ++FLLHRW +N + CC Sbjct: 354 ILLFFLLHRWCSNKKKCCC 372 >AL133414-12|CAC40713.1| 287|Homo sapiens 1060P11.5.2 (killer cell immunoglobulin-like receptor, three domains, short cyt protein. Length = 287 Score = 30.7 bits (66), Expect = 4.9 Identities = 9/19 (47%), Positives = 14/19 (73%) Frame = +2 Query: 224 LFIYFLLHRWGTNSQPICC 280 + ++FLLHRW +N + CC Sbjct: 259 ILLFFLLHRWCSNKKKCCC 277 >AL133414-11|CAC40712.1| 382|Homo sapiens 1060P11.5.1 (killer cell immunoglobulin-like receptor, three domains, short cyt protein. Length = 382 Score = 30.7 bits (66), Expect = 4.9 Identities = 9/19 (47%), Positives = 14/19 (73%) Frame = +2 Query: 224 LFIYFLLHRWGTNSQPICC 280 + ++FLLHRW +N + CC Sbjct: 354 ILLFFLLHRWCSNKKKCCC 372 >AJ417558-1|CAD10382.2| 365|Homo sapiens killer cell immunoglobulin receptor protein. Length = 365 Score = 30.7 bits (66), Expect = 4.9 Identities = 9/19 (47%), Positives = 14/19 (73%) Frame = +2 Query: 224 LFIYFLLHRWGTNSQPICC 280 + ++FLLHRW +N + CC Sbjct: 337 ILLFFLLHRWCSNKKKCCC 355 >AF022044-1|AAB95317.1| 382|Homo sapiens natural killer cell receptor KIR3DS1 variant protein. Length = 382 Score = 30.7 bits (66), Expect = 4.9 Identities = 9/19 (47%), Positives = 14/19 (73%) Frame = +2 Query: 224 LFIYFLLHRWGTNSQPICC 280 + ++FLLHRW +N + CC Sbjct: 354 ILLFFLLHRWCSNKKKCCC 372 >AF001883-1|AAB94765.1| 163|Homo sapiens NK-receptor protein. Length = 163 Score = 30.7 bits (66), Expect = 4.9 Identities = 9/19 (47%), Positives = 14/19 (73%) Frame = +2 Query: 224 LFIYFLLHRWGTNSQPICC 280 + ++FLLHRW +N + CC Sbjct: 135 ILLFFLLHRWCSNKKKCCC 153 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 103,563,858 Number of Sequences: 237096 Number of extensions: 2192586 Number of successful extensions: 4148 Number of sequences better than 10.0: 26 Number of HSP's better than 10.0 without gapping: 3866 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4148 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 7615267504 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -