BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0277 (660 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_02_0648 - 19694538-19696569,19697151-19697998 30 1.4 12_01_0144 - 1097579-1097604,1097940-1098127,1098567-1098720,109... 30 1.9 03_05_1096 - 30364144-30365310,30365825-30365971,30366087-303663... 28 7.6 >08_02_0648 - 19694538-19696569,19697151-19697998 Length = 959 Score = 30.3 bits (65), Expect = 1.4 Identities = 14/39 (35%), Positives = 21/39 (53%) Frame = -2 Query: 479 MARIFLYQHANVI*ILGGCGKNYMSHTCTRTKLCLVDYY 363 + R+ + HA++ GCG ++ H T KL LVD Y Sbjct: 864 LQRLNIRYHAHITVPERGCGSDFSIHQLTSLKLFLVDIY 902 >12_01_0144 - 1097579-1097604,1097940-1098127,1098567-1098720, 1098825-1099092,1099310-1099550,1099669-1099833, 1099898-1100298 Length = 480 Score = 29.9 bits (64), Expect = 1.9 Identities = 16/31 (51%), Positives = 19/31 (61%) Frame = -1 Query: 141 LRIFTLILPLNCSIIIGPLMFSLYLYGDIQS 49 LRIF ILP C I++GP + LY DI S Sbjct: 260 LRIFAHILPFECYIVLGPRI----LYRDIAS 286 >03_05_1096 - 30364144-30365310,30365825-30365971,30366087-30366393, 30366541-30366849,30367544-30370567,30370640-30372290, 30372373-30373463,30373544-30373646,30373737-30374439, 30374654-30375783,30375913-30376027,30376504-30376695, 30377443-30377616,30378438-30378494,30378581-30378716, 30378842-30378927,30379023-30379092,30379993-30380021, 30380444-30380456,30380762-30381006 Length = 3582 Score = 27.9 bits (59), Expect = 7.6 Identities = 13/42 (30%), Positives = 19/42 (45%) Frame = +2 Query: 329 HNTSNRDCNNVSNSPPDKASSLYKCDSCSSYRIHLRSILHWH 454 H TS+ N+ S SPP + YR+ L+ +L H Sbjct: 3503 HYTSDEAANSKSKSPPSTLGGMSLNGQTQEYRLLLQKVLKAH 3544 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,311,859 Number of Sequences: 37544 Number of extensions: 304423 Number of successful extensions: 688 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 664 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 687 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1655832080 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -