BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0268 (466 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ026039-1|AAY87898.1| 427|Apis mellifera nicotinic acetylcholi... 28 0.043 DQ325109-1|ABD14123.1| 177|Apis mellifera complementary sex det... 22 2.8 DQ325108-1|ABD14122.1| 177|Apis mellifera complementary sex det... 22 2.8 DQ325106-1|ABD14120.1| 177|Apis mellifera complementary sex det... 22 2.8 AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex det... 22 2.8 DQ325107-1|ABD14121.1| 176|Apis mellifera complementary sex det... 22 3.7 DQ325077-1|ABD14091.1| 181|Apis mellifera complementary sex det... 22 3.7 DQ325101-1|ABD14115.1| 182|Apis mellifera complementary sex det... 21 4.9 AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex det... 21 4.9 AF498306-5|AAM19330.1| 456|Apis mellifera dopamine receptor typ... 21 4.9 DQ435327-1|ABD92642.1| 145|Apis mellifera OBP10 protein. 21 6.5 DQ325105-1|ABD14119.1| 180|Apis mellifera complementary sex det... 21 6.5 DQ325104-1|ABD14118.1| 180|Apis mellifera complementary sex det... 21 6.5 DQ325102-1|ABD14116.1| 183|Apis mellifera complementary sex det... 21 6.5 DQ325100-1|ABD14114.1| 183|Apis mellifera complementary sex det... 21 6.5 DQ325099-1|ABD14113.1| 183|Apis mellifera complementary sex det... 21 6.5 DQ325098-1|ABD14112.1| 183|Apis mellifera complementary sex det... 21 6.5 DQ325097-1|ABD14111.1| 183|Apis mellifera complementary sex det... 21 6.5 DQ325096-1|ABD14110.1| 183|Apis mellifera complementary sex det... 21 6.5 DQ325095-1|ABD14109.1| 183|Apis mellifera complementary sex det... 21 6.5 DQ325081-1|ABD14095.1| 186|Apis mellifera complementary sex det... 21 6.5 DQ325076-1|ABD14090.1| 191|Apis mellifera complementary sex det... 21 6.5 AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex det... 21 6.5 AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex det... 21 6.5 AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex det... 21 6.5 DQ325103-1|ABD14117.1| 182|Apis mellifera complementary sex det... 21 8.6 >DQ026039-1|AAY87898.1| 427|Apis mellifera nicotinic acetylcholine receptor beta2subunit protein. Length = 427 Score = 28.3 bits (60), Expect = 0.043 Identities = 10/29 (34%), Positives = 19/29 (65%) Frame = -3 Query: 434 VNIVIDKIKCIIFNSHYLLVEPFPLPTPL 348 +++ + ++CI+FNS +L PF TP+ Sbjct: 130 IDLEMPSVECIVFNSGTILCVPFTTYTPV 158 >DQ325109-1|ABD14123.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 22.2 bits (45), Expect = 2.8 Identities = 7/18 (38%), Positives = 12/18 (66%) Frame = -3 Query: 398 FNSHYLLVEPFPLPTPLP 345 +N +Y+ P P+P P+P Sbjct: 103 YNINYIEQIPVPVPVPVP 120 >DQ325108-1|ABD14122.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 22.2 bits (45), Expect = 2.8 Identities = 7/18 (38%), Positives = 12/18 (66%) Frame = -3 Query: 398 FNSHYLLVEPFPLPTPLP 345 +N +Y+ P P+P P+P Sbjct: 103 YNINYIEQIPVPVPVPVP 120 >DQ325106-1|ABD14120.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 22.2 bits (45), Expect = 2.8 Identities = 7/18 (38%), Positives = 12/18 (66%) Frame = -3 Query: 398 FNSHYLLVEPFPLPTPLP 345 +N +Y+ P P+P P+P Sbjct: 103 YNINYIEQIPVPVPVPVP 120 >AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex determiner protein. Length = 410 Score = 22.2 bits (45), Expect = 2.8 Identities = 7/18 (38%), Positives = 12/18 (66%) Frame = -3 Query: 398 FNSHYLLVEPFPLPTPLP 345 +N +Y+ P P+P P+P Sbjct: 336 YNINYIEQIPVPVPVPVP 353 >DQ325107-1|ABD14121.1| 176|Apis mellifera complementary sex determiner protein. Length = 176 Score = 21.8 bits (44), Expect = 3.7 Identities = 7/18 (38%), Positives = 12/18 (66%) Frame = -3 Query: 398 FNSHYLLVEPFPLPTPLP 345 +N +Y+ P P+P P+P Sbjct: 103 YNINYIEQIPVPVPIPVP 120 >DQ325077-1|ABD14091.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.8 bits (44), Expect = 3.7 Identities = 7/21 (33%), Positives = 13/21 (61%) Frame = -3 Query: 410 KCIIFNSHYLLVEPFPLPTPL 348 K + +N +Y+ P P+P P+ Sbjct: 105 KKLYYNINYIEQVPVPIPVPI 125 >DQ325101-1|ABD14115.1| 182|Apis mellifera complementary sex determiner protein. Length = 182 Score = 21.4 bits (43), Expect = 4.9 Identities = 7/21 (33%), Positives = 13/21 (61%) Frame = -3 Query: 410 KCIIFNSHYLLVEPFPLPTPL 348 K + +N +Y+ P P+P P+ Sbjct: 107 KKLYYNINYIEQIPIPVPVPI 127 >AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 21.4 bits (43), Expect = 4.9 Identities = 7/21 (33%), Positives = 13/21 (61%) Frame = -3 Query: 410 KCIIFNSHYLLVEPFPLPTPL 348 K + +N +Y+ P P+P P+ Sbjct: 324 KKLYYNINYIEQIPIPVPVPI 344 >AF498306-5|AAM19330.1| 456|Apis mellifera dopamine receptor type D2 protein. Length = 456 Score = 21.4 bits (43), Expect = 4.9 Identities = 13/50 (26%), Positives = 23/50 (46%) Frame = -3 Query: 320 RPMLSRLDLIINLYLRFLNTMQSFQCVASRFLFFKGFYDLVTKTFSSCLI 171 R L+ L + ++ F NT+ V R+L Y + + F+ CL+ Sbjct: 45 RAGLAILLFLFSVATVFGNTLVILAVVRERYLHTATNYFVTSLAFADCLV 94 >DQ435327-1|ABD92642.1| 145|Apis mellifera OBP10 protein. Length = 145 Score = 21.0 bits (42), Expect = 6.5 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = -2 Query: 435 CKYCYR*NKMY 403 C+Y YR NK Y Sbjct: 124 CEYAYRFNKCY 134 >DQ325105-1|ABD14119.1| 180|Apis mellifera complementary sex determiner protein. Length = 180 Score = 21.0 bits (42), Expect = 6.5 Identities = 7/21 (33%), Positives = 13/21 (61%) Frame = -3 Query: 410 KCIIFNSHYLLVEPFPLPTPL 348 K + +N +Y+ P P+P P+ Sbjct: 104 KKLYYNINYIEQIPVPVPVPI 124 >DQ325104-1|ABD14118.1| 180|Apis mellifera complementary sex determiner protein. Length = 180 Score = 21.0 bits (42), Expect = 6.5 Identities = 7/21 (33%), Positives = 13/21 (61%) Frame = -3 Query: 410 KCIIFNSHYLLVEPFPLPTPL 348 K + +N +Y+ P P+P P+ Sbjct: 104 KKLYYNINYIEQIPVPVPVPI 124 >DQ325102-1|ABD14116.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 21.0 bits (42), Expect = 6.5 Identities = 7/21 (33%), Positives = 13/21 (61%) Frame = -3 Query: 410 KCIIFNSHYLLVEPFPLPTPL 348 K + +N +Y+ P P+P P+ Sbjct: 107 KKLYYNINYIEQIPVPVPVPI 127 >DQ325100-1|ABD14114.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 21.0 bits (42), Expect = 6.5 Identities = 7/21 (33%), Positives = 13/21 (61%) Frame = -3 Query: 410 KCIIFNSHYLLVEPFPLPTPL 348 K + +N +Y+ P P+P P+ Sbjct: 107 KKLYYNINYIEQIPVPVPVPI 127 >DQ325099-1|ABD14113.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 21.0 bits (42), Expect = 6.5 Identities = 7/21 (33%), Positives = 13/21 (61%) Frame = -3 Query: 410 KCIIFNSHYLLVEPFPLPTPL 348 K + +N +Y+ P P+P P+ Sbjct: 107 KKLYYNINYIEQIPVPVPVPI 127 >DQ325098-1|ABD14112.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 21.0 bits (42), Expect = 6.5 Identities = 7/21 (33%), Positives = 13/21 (61%) Frame = -3 Query: 410 KCIIFNSHYLLVEPFPLPTPL 348 K + +N +Y+ P P+P P+ Sbjct: 107 KKLYYNINYIEQIPVPVPVPI 127 >DQ325097-1|ABD14111.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 21.0 bits (42), Expect = 6.5 Identities = 7/21 (33%), Positives = 13/21 (61%) Frame = -3 Query: 410 KCIIFNSHYLLVEPFPLPTPL 348 K + +N +Y+ P P+P P+ Sbjct: 107 KKLYYNINYIEQIPVPVPVPI 127 >DQ325096-1|ABD14110.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 21.0 bits (42), Expect = 6.5 Identities = 7/21 (33%), Positives = 13/21 (61%) Frame = -3 Query: 410 KCIIFNSHYLLVEPFPLPTPL 348 K + +N +Y+ P P+P P+ Sbjct: 107 KKLYYNINYIEQIPVPVPVPI 127 >DQ325095-1|ABD14109.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 21.0 bits (42), Expect = 6.5 Identities = 7/21 (33%), Positives = 13/21 (61%) Frame = -3 Query: 410 KCIIFNSHYLLVEPFPLPTPL 348 K + +N +Y+ P P+P P+ Sbjct: 107 KKLYYNINYIEQIPVPVPVPI 127 >DQ325081-1|ABD14095.1| 186|Apis mellifera complementary sex determiner protein. Length = 186 Score = 21.0 bits (42), Expect = 6.5 Identities = 7/21 (33%), Positives = 13/21 (61%) Frame = -3 Query: 410 KCIIFNSHYLLVEPFPLPTPL 348 K + +N +Y+ P P+P P+ Sbjct: 110 KKLYYNINYIEQIPVPVPVPI 130 >DQ325076-1|ABD14090.1| 191|Apis mellifera complementary sex determiner protein. Length = 191 Score = 21.0 bits (42), Expect = 6.5 Identities = 7/21 (33%), Positives = 13/21 (61%) Frame = -3 Query: 410 KCIIFNSHYLLVEPFPLPTPL 348 K + +N +Y+ P P+P P+ Sbjct: 115 KKLYYNINYIEQIPVPVPVPI 135 >AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 21.0 bits (42), Expect = 6.5 Identities = 7/21 (33%), Positives = 13/21 (61%) Frame = -3 Query: 410 KCIIFNSHYLLVEPFPLPTPL 348 K + +N +Y+ P P+P P+ Sbjct: 324 KKLYYNINYIEQIPVPVPVPI 344 >AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex determiner protein. Length = 418 Score = 21.0 bits (42), Expect = 6.5 Identities = 7/21 (33%), Positives = 13/21 (61%) Frame = -3 Query: 410 KCIIFNSHYLLVEPFPLPTPL 348 K + +N +Y+ P P+P P+ Sbjct: 342 KKLYYNINYIEQIPVPVPVPI 362 >AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex determiner protein. Length = 425 Score = 21.0 bits (42), Expect = 6.5 Identities = 7/21 (33%), Positives = 13/21 (61%) Frame = -3 Query: 410 KCIIFNSHYLLVEPFPLPTPL 348 K + +N +Y+ P P+P P+ Sbjct: 349 KKLYYNINYIEQIPVPVPVPI 369 >DQ325103-1|ABD14117.1| 182|Apis mellifera complementary sex determiner protein. Length = 182 Score = 20.6 bits (41), Expect = 8.6 Identities = 7/21 (33%), Positives = 13/21 (61%) Frame = -3 Query: 410 KCIIFNSHYLLVEPFPLPTPL 348 K + +N +Y+ P P+P P+ Sbjct: 106 KKLYYNINYIEQIPVPVPVPV 126 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 143,685 Number of Sequences: 438 Number of extensions: 3224 Number of successful extensions: 26 Number of sequences better than 10.0: 26 Number of HSP's better than 10.0 without gapping: 26 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 26 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 12436029 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -