BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0267 (565 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_13207| Best HMM Match : Extensin_2 (HMM E-Value=0.061) 39 0.002 SB_49936| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.017 SB_36095| Best HMM Match : DMP1 (HMM E-Value=3.2) 32 0.37 SB_59202| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.49 SB_13206| Best HMM Match : Extensin_2 (HMM E-Value=0.031) 31 0.49 SB_46911| Best HMM Match : MSSP (HMM E-Value=4.4) 31 0.86 SB_44647| Best HMM Match : C_tripleX (HMM E-Value=0.00011) 31 0.86 SB_40220| Best HMM Match : RTP801_C (HMM E-Value=2.4) 31 0.86 SB_18731| Best HMM Match : DUF1309 (HMM E-Value=2) 31 0.86 SB_39016| Best HMM Match : Extensin_2 (HMM E-Value=0.53) 30 1.1 SB_55591| Best HMM Match : TIL (HMM E-Value=4.2e-09) 30 1.1 SB_45775| Best HMM Match : Extensin_2 (HMM E-Value=2.3) 30 1.5 SB_57270| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.5 SB_33073| Best HMM Match : Protamine_P1 (HMM E-Value=1.5) 30 1.5 SB_19560| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_13377| Best HMM Match : Extensin_2 (HMM E-Value=0.00046) 29 2.6 SB_39921| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.5 SB_48810| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.5 SB_29938| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.6 SB_25560| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.6 SB_14763| Best HMM Match : Zona_pellucida (HMM E-Value=0) 28 4.6 SB_53929| Best HMM Match : Amelogenin (HMM E-Value=3.6) 28 6.1 SB_16587| Best HMM Match : Cytadhesin_P30 (HMM E-Value=0.69) 28 6.1 SB_13048| Best HMM Match : Fork_head (HMM E-Value=0) 28 6.1 SB_23501| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.0 SB_3877| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.0 SB_687| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.0 SB_56543| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.0 SB_43809| Best HMM Match : PSGP (HMM E-Value=0.069) 27 8.0 SB_40727| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.0 SB_18399| Best HMM Match : AMP-binding (HMM E-Value=0) 27 8.0 SB_6222| Best HMM Match : zf-C2H2 (HMM E-Value=7.6) 27 8.0 >SB_13207| Best HMM Match : Extensin_2 (HMM E-Value=0.061) Length = 2735 Score = 39.1 bits (87), Expect = 0.002 Identities = 25/86 (29%), Positives = 37/86 (43%), Gaps = 2/86 (2%) Frame = +1 Query: 88 PVHYSPAEAVSSQSIVRHDQPQLHAAKLAVATPVAYHAAPVAYQADPVAYHAAPVATRPP 267 P+ Y+P+ V + V QP A + PV YH AP+ P+ YH PV P Sbjct: 435 PLVYTPSPDVFANPPVIVPQP----AVIVQRPPVVYHQAPLVVHKPPIVYHRPPVVMPAP 490 Query: 268 QLPTTLLHSGTP--RLNLARSKTSSV 339 + H G + +A++K V Sbjct: 491 IYHMPVYHHGYAFGKAKIAKTKLKKV 516 Score = 33.5 bits (73), Expect = 0.12 Identities = 22/71 (30%), Positives = 29/71 (40%), Gaps = 3/71 (4%) Frame = +1 Query: 91 VHYSPAEAVSSQSIVRHDQP-QLHAAKLAVATPVAYHAAPVAYQADPVAYHAAPVATR-- 261 +++ P E IV H P LH P+ YH PV V YH P+ Sbjct: 1523 IYHPPPEVYHRPDIVVHRAPIVLHRP------PIIYHQPPVIVHRPAVVYHQPPIVFHQP 1576 Query: 262 PPQLPTTLLHS 294 PP + +LHS Sbjct: 1577 PPAVHQPVLHS 1587 Score = 32.3 bits (70), Expect = 0.28 Identities = 20/70 (28%), Positives = 28/70 (40%), Gaps = 2/70 (2%) Frame = +1 Query: 91 VHYSPAEAVSSQSIVRHDQPQLHAAKLAVATPVAYHAAPVAYQADPVAYHAAPVATR--P 264 +++ P E IV H P L P+ YH PV V YH P+ P Sbjct: 27 IYHPPPEVYHRPEIVVHRAPIL-----IHRPPIVYHQPPVVVHRPAVVYHQPPIVFHQPP 81 Query: 265 PQLPTTLLHS 294 P + +L+S Sbjct: 82 PAVNQPMLYS 91 Score = 31.9 bits (69), Expect = 0.37 Identities = 19/57 (33%), Positives = 26/57 (45%), Gaps = 5/57 (8%) Frame = +1 Query: 139 HDQPQL--HAAKLAVATP-VAYHAAPVAYQADPVAYHAAPVATR--PPQLPTTLLHS 294 +D+P + H L V P + YH V P+ YH PV PP + +LHS Sbjct: 711 YDRPDVVVHRPDLVVHRPSIVYHQPSVVVHRPPIIYHQPPVMFHQPPPLVHQPVLHS 767 Score = 31.5 bits (68), Expect = 0.49 Identities = 17/50 (34%), Positives = 22/50 (44%), Gaps = 3/50 (6%) Frame = +1 Query: 154 LHAAKLAVATP-VAYHAAPVAYQADPVAYHAAPVATR--PPQLPTTLLHS 294 LH + + P V H APV V YH PV PP + ++HS Sbjct: 1376 LHRPDIVIHRPSVVLHQAPVVVHRPAVVYHQPPVVVHQPPPLVHQPIIHS 1425 Score = 30.7 bits (66), Expect = 0.86 Identities = 17/57 (29%), Positives = 25/57 (43%), Gaps = 5/57 (8%) Frame = +1 Query: 139 HDQPQL--HAAKLAVATP-VAYHAAPVAYQADPVAYHAAPVATR--PPQLPTTLLHS 294 +D+P + H + P V YH V P+ YH PV PP + ++HS Sbjct: 552 YDRPDVVVHQPDYVIHRPSVVYHQPSVVVHRPPIVYHQPPVVFHQPPPMVRQPVMHS 608 Score = 29.9 bits (64), Expect = 1.5 Identities = 15/46 (32%), Positives = 20/46 (43%), Gaps = 3/46 (6%) Frame = +1 Query: 139 HDQPQL--HAAKLAVATP-VAYHAAPVAYQADPVAYHAAPVATRPP 267 +D+P + H L P + YH A V P+ YH PV P Sbjct: 253 YDRPDVIVHRPDLVYHQPSIVYHQASVVIHRPPIVYHQPPVVFHQP 298 Score = 29.1 bits (62), Expect = 2.6 Identities = 13/40 (32%), Positives = 19/40 (47%), Gaps = 4/40 (10%) Frame = +1 Query: 184 PVAYHAAPVAYQADPVAYHAAPVAT-RPPQL---PTTLLH 291 P+ YH P Y + H AP+ RPP + P ++H Sbjct: 1521 PIIYHPPPEVYHRPDIVVHRAPIVLHRPPIIYHQPPVIVH 1560 Score = 28.3 bits (60), Expect = 4.6 Identities = 11/29 (37%), Positives = 14/29 (48%), Gaps = 1/29 (3%) Frame = +1 Query: 184 PVAYHAAPVAYQADPVAYHAAPVAT-RPP 267 P+ YH P Y + H AP+ RPP Sbjct: 25 PIIYHPPPEVYHRPEIVVHRAPILIHRPP 53 Score = 28.3 bits (60), Expect = 4.6 Identities = 14/46 (30%), Positives = 20/46 (43%), Gaps = 3/46 (6%) Frame = +1 Query: 139 HDQPQL--HAAKLAVATP-VAYHAAPVAYQADPVAYHAAPVATRPP 267 +D+P + H L P + YH V P+ YH+ PV P Sbjct: 1069 YDRPNVIVHRPDLVYHQPSIVYHQPSVVVHRPPIIYHSPPVVFHQP 1114 >SB_49936| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 526 Score = 36.3 bits (80), Expect = 0.017 Identities = 20/54 (37%), Positives = 21/54 (38%), Gaps = 5/54 (9%) Frame = +3 Query: 156 PRCQAR--CCY---PCSLPRGPCSVPGRPSCLPRGPCSYQAAPVAYHTSPLRYS 302 PRC C Y PC PC RP C PC Y P Y P RY+ Sbjct: 183 PRCYTLRPCRYMLRPCRYMLRPCRYMLRPCCYTLRPCRYMLRPCRYTLRPCRYT 236 Score = 35.5 bits (78), Expect = 0.030 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +3 Query: 183 PCSLPRGPCSVPGRPSCLPRGPCSYQAAPVAYHTSPLRY 299 PC PC RP C PC Y P Y P RY Sbjct: 169 PCRYTLRPCRYTLRPRCYTLRPCRYMLRPCRYMLRPCRY 207 Score = 34.7 bits (76), Expect = 0.053 Identities = 18/51 (35%), Positives = 19/51 (37%), Gaps = 3/51 (5%) Frame = +3 Query: 174 CCY---PCSLPRGPCSVPGRPSCLPRGPCSYQAAPVAYHTSPLRYSSAESG 317 CCY PC PC RP PC Y P Y P RY+ G Sbjct: 212 CCYTLRPCRYMLRPCRYTLRPCRYTLRPCRYTLRPCRYTLRPCRYTLRPCG 262 Score = 31.5 bits (68), Expect = 0.49 Identities = 14/40 (35%), Positives = 15/40 (37%) Frame = +3 Query: 183 PCSLPRGPCSVPGRPSCLPRGPCSYQAAPVAYHTSPLRYS 302 PC PC RP PC Y P Y P RY+ Sbjct: 260 PCGYTLRPCGYTLRPHRYTLRPCRYTLRPCRYTLRPCRYT 299 Score = 30.7 bits (66), Expect = 0.86 Identities = 14/40 (35%), Positives = 15/40 (37%) Frame = +3 Query: 183 PCSLPRGPCSVPGRPSCLPRGPCSYQAAPVAYHTSPLRYS 302 PC PC RP PC Y P Y P RY+ Sbjct: 239 PCRYTLRPCRYTLRPCRYTLRPCGYTLRPCGYTLRPHRYT 278 Score = 30.7 bits (66), Expect = 0.86 Identities = 13/40 (32%), Positives = 14/40 (35%) Frame = +3 Query: 183 PCSLPRGPCSVPGRPSCLPRGPCSYQAAPVAYHTSPLRYS 302 PC PC RP C PC Y Y P Y+ Sbjct: 386 PCRYTLSPCRYTLRPRCCTLRPCRYTLRTCRYALRPRHYT 425 Score = 30.7 bits (66), Expect = 0.86 Identities = 14/39 (35%), Positives = 15/39 (38%) Frame = +3 Query: 183 PCSLPRGPCSVPGRPSCLPRGPCSYQAAPVAYHTSPLRY 299 PC PC RP PC Y+ P Y P RY Sbjct: 449 PCRYMLRPCRYTLRPCRYMLRPCRYRLRPCGYTLRPCRY 487 Score = 30.3 bits (65), Expect = 1.1 Identities = 14/40 (35%), Positives = 15/40 (37%) Frame = +3 Query: 183 PCSLPRGPCSVPGRPSCLPRGPCSYQAAPVAYHTSPLRYS 302 PC PC RP PC Y P Y P RY+ Sbjct: 211 PCCYTLRPCRYMLRPCRYTLRPCRYTLRPCRYTLRPCRYT 250 Score = 30.3 bits (65), Expect = 1.1 Identities = 14/40 (35%), Positives = 15/40 (37%) Frame = +3 Query: 183 PCSLPRGPCSVPGRPSCLPRGPCSYQAAPVAYHTSPLRYS 302 PC PC RP PC Y P Y P RY+ Sbjct: 246 PCRYTLRPCRYTLRPCGYTLRPCGYTLRPHRYTLRPCRYT 285 Score = 30.3 bits (65), Expect = 1.1 Identities = 14/40 (35%), Positives = 15/40 (37%) Frame = +3 Query: 183 PCSLPRGPCSVPGRPSCLPRGPCSYQAAPVAYHTSPLRYS 302 PC PC RP PC Y P Y P RY+ Sbjct: 456 PCRYTLRPCRYMLRPCRYRLRPCGYTLRPCRYMLRPCRYT 495 Score = 30.3 bits (65), Expect = 1.1 Identities = 14/40 (35%), Positives = 15/40 (37%) Frame = +3 Query: 183 PCSLPRGPCSVPGRPSCLPRGPCSYQAAPVAYHTSPLRYS 302 PC PC RP PC Y P Y P RY+ Sbjct: 463 PCRYMLRPCRYRLRPCGYTLRPCRYMLRPCRYTLRPCRYT 502 Score = 29.9 bits (64), Expect = 1.5 Identities = 14/40 (35%), Positives = 15/40 (37%) Frame = +3 Query: 183 PCSLPRGPCSVPGRPSCLPRGPCSYQAAPVAYHTSPLRYS 302 PC PC RP PC Y P Y P RY+ Sbjct: 204 PCRYMLRPCCYTLRPCRYMLRPCRYTLRPCRYTLRPCRYT 243 Score = 29.9 bits (64), Expect = 1.5 Identities = 14/40 (35%), Positives = 15/40 (37%) Frame = +3 Query: 183 PCSLPRGPCSVPGRPSCLPRGPCSYQAAPVAYHTSPLRYS 302 PC PC RP PC Y P Y P RY+ Sbjct: 281 PCRYTLRPCRYTLRPCRYTLRPCRYTLRPRRYTLRPCRYT 320 Score = 29.5 bits (63), Expect = 2.0 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +3 Query: 183 PCSLPRGPCSVPGRPSCLPRGPCSYQAAPVAYHTSPLRY 299 PC PC RP PC Y P Y P RY Sbjct: 435 PCRYTLRPCRYMLRPCRYMLRPCRYTLRPCRYMLRPCRY 473 Score = 28.7 bits (61), Expect = 3.5 Identities = 13/40 (32%), Positives = 15/40 (37%) Frame = +3 Query: 183 PCSLPRGPCSVPGRPSCLPRGPCSYQAAPVAYHTSPLRYS 302 PC PC RP PC Y P Y P R++ Sbjct: 470 PCRYRLRPCGYTLRPCRYMLRPCRYTLRPCRYTLRPCRFT 509 Score = 28.3 bits (60), Expect = 4.6 Identities = 14/45 (31%), Positives = 15/45 (33%) Frame = +3 Query: 183 PCSLPRGPCSVPGRPSCLPRGPCSYQAAPVAYHTSPLRYSSAESG 317 PC PC RP PC Y P Y P Y+ G Sbjct: 225 PCRYTLRPCRYTLRPCRYTLRPCRYTLRPCRYTLRPCGYTLRPCG 269 Score = 28.3 bits (60), Expect = 4.6 Identities = 13/40 (32%), Positives = 14/40 (35%) Frame = +3 Query: 183 PCSLPRGPCSVPGRPSCLPRGPCSYQAAPVAYHTSPLRYS 302 PC PC RP PC Y P Y P Y+ Sbjct: 232 PCRYTLRPCRYTLRPCRYTLRPCRYTLRPCGYTLRPCGYT 271 Score = 28.3 bits (60), Expect = 4.6 Identities = 13/40 (32%), Positives = 14/40 (35%) Frame = +3 Query: 183 PCSLPRGPCSVPGRPSCLPRGPCSYQAAPVAYHTSPLRYS 302 PC PC RP PC Y P Y P Y+ Sbjct: 442 PCRYMLRPCRYMLRPCRYTLRPCRYMLRPCRYRLRPCGYT 481 Score = 27.9 bits (59), Expect = 6.1 Identities = 13/40 (32%), Positives = 14/40 (35%) Frame = +3 Query: 183 PCSLPRGPCSVPGRPSCLPRGPCSYQAAPVAYHTSPLRYS 302 PC PC RP PC Y P Y P Y+ Sbjct: 295 PCRYTLRPCRYTLRPRRYTLRPCRYTLRPCRYTLRPCGYT 334 >SB_36095| Best HMM Match : DMP1 (HMM E-Value=3.2) Length = 939 Score = 31.9 bits (69), Expect = 0.37 Identities = 20/62 (32%), Positives = 28/62 (45%), Gaps = 2/62 (3%) Frame = +3 Query: 120 FPKHCAP*PASAPRCQARCC-YPCSLPRGPCSVPGRPSCLPRGPCSYQA-APVAYHTSPL 293 +P PA P A+ YP P P VPG P+ +P P A + V Y +SP Sbjct: 875 YPAQAPGYPAQVPGYPAQVPGYPAQAPGCPAQVPGYPAQVPGYPAQVPAGSSVQYVSSPQ 934 Query: 294 RY 299 ++ Sbjct: 935 QF 936 Score = 30.3 bits (65), Expect = 1.1 Identities = 18/58 (31%), Positives = 23/58 (39%), Gaps = 1/58 (1%) Frame = +3 Query: 144 PASAPRCQARCC-YPCSLPRGPCSVPGRPSCLPRGPCSYQAAPVAYHTSPLRYSSAES 314 PA AP A+ YP +P P VPG P+ P P P P + + S Sbjct: 869 PAQAPGYPAQAPGYPAQVPGYPAQVPGYPAQAPGCPAQVPGYPAQVPGYPAQVPAGSS 926 >SB_59202| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1530 Score = 31.5 bits (68), Expect = 0.49 Identities = 16/64 (25%), Positives = 26/64 (40%) Frame = +3 Query: 123 PKHCAP*PASAPRCQARCCYPCSLPRGPCSVPGRPSCLPRGPCSYQAAPVAYHTSPLRYS 302 P+ C+ + C ++C C P G + R C+ G CS + + Y +R S Sbjct: 770 PRDCSNMNSDPNACNSKCVDGCFCPEG--KIQDRGKCVDPGQCSCYHSGIPYAHGAIRKS 827 Query: 303 SAES 314 S Sbjct: 828 ECSS 831 >SB_13206| Best HMM Match : Extensin_2 (HMM E-Value=0.031) Length = 1099 Score = 31.5 bits (68), Expect = 0.49 Identities = 15/50 (30%), Positives = 23/50 (46%), Gaps = 2/50 (4%) Frame = +1 Query: 130 IVRHDQPQL-HAAKLAV-ATPVAYHAAPVAYQADPVAYHAAPVATRPPQL 273 I+ H P++ H + V P+ H AP+ Y PV H + P+L Sbjct: 465 IIYHPPPEIFHRPDIVVHRAPLMVHRAPIIYHQPPVIVHRPAIVYHQPEL 514 Score = 29.9 bits (64), Expect = 1.5 Identities = 20/70 (28%), Positives = 27/70 (38%), Gaps = 2/70 (2%) Frame = +1 Query: 91 VHYSPAEAVSSQSIVRHDQPQLHAAKLAVATPVAYHAAPVAYQADPVAYHAAPVATR--P 264 +++ P E IV H P + P+ YH PV V YH P+ P Sbjct: 150 IYHPPPEIYHRPDIVVHRPPLV-----IHRPPIIYHQPPVIVHRPAVVYHQPPIIFHQPP 204 Query: 265 PQLPTTLLHS 294 P + LL S Sbjct: 205 PAVSQPLLFS 214 Score = 29.9 bits (64), Expect = 1.5 Identities = 17/68 (25%), Positives = 29/68 (42%), Gaps = 6/68 (8%) Frame = +1 Query: 127 SIVRHDQPQLH--AAKLAVATPVAYHAAPVAYQADPVAYHAAPVATRPPQL----PTTLL 288 S+V H P ++ ++ + H AP+ P+ YH PV P + P+ + Sbjct: 673 SVVIHRPPIIYHPPPEIYHRPDIIVHRAPIVLYRAPIIYHQPPVVVHRPAIVYHQPSIVF 732 Query: 289 HSGTPRLN 312 H P +N Sbjct: 733 HQPPPVVN 740 Score = 28.7 bits (61), Expect = 3.5 Identities = 16/60 (26%), Positives = 23/60 (38%), Gaps = 1/60 (1%) Frame = +1 Query: 91 VHYSPAEAVSSQSIVRHDQP-QLHAAKLAVATPVAYHAAPVAYQADPVAYHAAPVATRPP 267 +++ P E IV H P +H A P+ YH PV + YH + P Sbjct: 307 IYHPPPEIYHRPDIVVHRAPIMIHRA------PIIYHQPPVVVHRPAIVYHQPSIVFHQP 360 Score = 28.3 bits (60), Expect = 4.6 Identities = 12/43 (27%), Positives = 18/43 (41%), Gaps = 4/43 (9%) Frame = +1 Query: 187 VAYHAAPVAYQADPVAYHAAPVATRPPQL----PTTLLHSGTP 303 + H AP+ P+ YH PV P + P+ + H P Sbjct: 320 IVVHRAPIMIHRAPIIYHQPPVVVHRPAIVYHQPSIVFHQPPP 362 >SB_46911| Best HMM Match : MSSP (HMM E-Value=4.4) Length = 424 Score = 30.7 bits (66), Expect = 0.86 Identities = 14/44 (31%), Positives = 21/44 (47%) Frame = +3 Query: 195 PRGPCSVPGRPSCLPRGPCSYQAAPVAYHTSPLRYSSAESGSFQ 326 P GPC+ S P GPC++Q ++ + L + SFQ Sbjct: 86 PTGPCASHVIISTTPTGPCAFQLIIISTNRHTLLSRDCQDSSFQ 129 >SB_44647| Best HMM Match : C_tripleX (HMM E-Value=0.00011) Length = 812 Score = 30.7 bits (66), Expect = 0.86 Identities = 21/64 (32%), Positives = 30/64 (46%), Gaps = 3/64 (4%) Frame = +3 Query: 144 PASAPRCQARCC--YPCSLPRGPCSVPGRPSCLPRGPCSYQAAPVAYHTSPLRYSSAES- 314 P+ AP CC YP P P + P +P+ PR P + AAP +P +S + Sbjct: 507 PSCAPTYSPSCCGSYPAPQPPSPPAPPPKPAPPPRSPPA--AAPCNPAMAPQGCNSMQQP 564 Query: 315 GSFQ 326 G +Q Sbjct: 565 GMYQ 568 Score = 27.5 bits (58), Expect = 8.0 Identities = 19/66 (28%), Positives = 29/66 (43%), Gaps = 1/66 (1%) Frame = +3 Query: 156 PRC-QARCCYPCSLPRGPCSVPGRPSCLPRGPCSYQAAPVAYHTSPLRYSSAESGSFQNI 332 P C Q RCC ++P+GP P P + + P AP+ +P+ A + Q Sbjct: 441 PICIQHRCCN-ANMPQGPPPPPPPPPQMYQQPLMMPQAPMMMPQAPMMMPQAPM-TMQQQ 498 Query: 333 VRHDQP 350 + QP Sbjct: 499 AQMQQP 504 >SB_40220| Best HMM Match : RTP801_C (HMM E-Value=2.4) Length = 230 Score = 30.7 bits (66), Expect = 0.86 Identities = 13/30 (43%), Positives = 19/30 (63%) Frame = +1 Query: 109 EAVSSQSIVRHDQPQLHAAKLAVATPVAYH 198 EA I+R D+ L AAK+A+ +P+ YH Sbjct: 114 EARELLDIIRKDETSLAAAKIAIKSPMLYH 143 >SB_18731| Best HMM Match : DUF1309 (HMM E-Value=2) Length = 356 Score = 30.7 bits (66), Expect = 0.86 Identities = 20/71 (28%), Positives = 28/71 (39%), Gaps = 3/71 (4%) Frame = +1 Query: 91 VHYSPAEAVSSQSIVRHDQP-QLHAAKLAVATPVAYHAAPVAYQADPVAYHAAPVATR-- 261 +++ P E IV H P LH + YH PV + YH P+ Sbjct: 158 IYHPPPEVYHRPDIVVHRAPIMLHRPA------IIYHQPPVVVHRPAIIYHQPPIVFHQP 211 Query: 262 PPQLPTTLLHS 294 PP + +LHS Sbjct: 212 PPVVNQPILHS 222 Score = 27.5 bits (58), Expect = 8.0 Identities = 9/30 (30%), Positives = 13/30 (43%) Frame = +1 Query: 184 PVAYHAAPVAYQADPVAYHAAPVATRPPQL 273 P+ YH P Y + H AP+ P + Sbjct: 156 PIIYHPPPEVYHRPDIVVHRAPIMLHRPAI 185 >SB_39016| Best HMM Match : Extensin_2 (HMM E-Value=0.53) Length = 287 Score = 30.3 bits (65), Expect = 1.1 Identities = 30/97 (30%), Positives = 44/97 (45%), Gaps = 2/97 (2%) Frame = +1 Query: 64 SKAGLLAAPVH-YSPAEAVSSQSIVRHDQPQLHAAKLAVATPVAYHAAPVAYQADPVAYH 240 S G AAP ++P+ +++ + V A A PV AAP A P A Sbjct: 69 SNTGTAAAPAQAFAPSAPLAAPAQVA----AAPAPAAAAPAPVPAAAAPAPAPAAPSAAA 124 Query: 241 A-APVATRPPQLPTTLLHSGTPRLNLARSKTSSVMTS 348 A APV + P P++ + S TP + + SSV +S Sbjct: 125 APAPVRSVPSTSPSS-VRSATPYYPQTQQQQSSVSSS 160 >SB_55591| Best HMM Match : TIL (HMM E-Value=4.2e-09) Length = 133 Score = 30.3 bits (65), Expect = 1.1 Identities = 15/64 (23%), Positives = 26/64 (40%) Frame = +3 Query: 123 PKHCAP*PASAPRCQARCCYPCSLPRGPCSVPGRPSCLPRGPCSYQAAPVAYHTSPLRYS 302 P+ C+ + C ++C C P G + R C+ G CS + + Y +R + Sbjct: 71 PRDCSNMNSDPNACNSKCVDGCFCPEG--KIQDRGKCVDPGQCSCYHSGIPYAHGAIRKT 128 Query: 303 SAES 314 S Sbjct: 129 ECSS 132 >SB_45775| Best HMM Match : Extensin_2 (HMM E-Value=2.3) Length = 584 Score = 29.9 bits (64), Expect = 1.5 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +1 Query: 178 ATPVAYHAAPVAYQADPVAYHAAP 249 A P YHA P Y P YHA P Sbjct: 275 AVPHGYHAVPHGYHEVPHGYHAVP 298 Score = 29.1 bits (62), Expect = 2.6 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +1 Query: 184 PVAYHAAPVAYQADPVAYHAAP 249 P YH P Y A P YHA P Sbjct: 263 PRGYHEVPYGYHAVPHGYHAVP 284 Score = 29.1 bits (62), Expect = 2.6 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +1 Query: 184 PVAYHAAPVAYQADPVAYHAAP 249 P YHA P Y A P YH P Sbjct: 270 PYGYHAVPHGYHAVPHGYHEVP 291 Score = 28.7 bits (61), Expect = 3.5 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = +1 Query: 169 LAVATPVAYHAAPVAYQADPVAYHAAP 249 L +A P YH P Y P YHA P Sbjct: 370 LYLAAPHGYHEMPHGYHEVPHGYHAVP 396 Score = 27.9 bits (59), Expect = 6.1 Identities = 11/25 (44%), Positives = 12/25 (48%) Frame = +1 Query: 175 VATPVAYHAAPVAYQADPVAYHAAP 249 +A P YH P Y P YHA P Sbjct: 323 LAAPHGYHEMPHGYHEVPHGYHAVP 347 >SB_57270| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 427 Score = 29.9 bits (64), Expect = 1.5 Identities = 17/63 (26%), Positives = 29/63 (46%), Gaps = 2/63 (3%) Frame = +3 Query: 183 PCSLPRGPCSVPGRPSCLPRGPCSYQAAPVAYHTSP--LRYSSAESGSFQNIVRHDQPQT 356 P ++ PC+V P + PC+ Q +P SP +++S V+H P T Sbjct: 103 PYTVQHSPCTVQHSPYTVQHSPCTVQHSPYTVQHSPYTVQHSPYAVQHSPYTVQH-SPYT 161 Query: 357 IQY 365 +Q+ Sbjct: 162 VQH 164 >SB_33073| Best HMM Match : Protamine_P1 (HMM E-Value=1.5) Length = 537 Score = 29.9 bits (64), Expect = 1.5 Identities = 18/59 (30%), Positives = 26/59 (44%), Gaps = 1/59 (1%) Frame = +1 Query: 91 VHYSPAEAVSSQSIVRHDQPQLHAAKLAVA-TPVAYHAAPVAYQADPVAYHAAPVATRP 264 V Y P + VR+ + +AV P+A P A + P+A P+ATRP Sbjct: 72 VRYRPIAVRYRPTAVRYRPIAVRYRPIAVRHRPIAVRYRPTAVRYRPIAVRYRPIATRP 130 Score = 29.9 bits (64), Expect = 1.5 Identities = 18/59 (30%), Positives = 26/59 (44%), Gaps = 1/59 (1%) Frame = +1 Query: 91 VHYSPAEAVSSQSIVRHDQPQLHAAKLAVA-TPVAYHAAPVAYQADPVAYHAAPVATRP 264 V Y P VR+ + +AV P+A P+A + P+A P+ATRP Sbjct: 140 VRYRPIAVRYRPIAVRYRPIAVRYRPIAVRYRPIAVRHRPIAVRHRPIAVRHRPIATRP 198 Score = 27.5 bits (58), Expect = 8.0 Identities = 16/58 (27%), Positives = 25/58 (43%), Gaps = 1/58 (1%) Frame = +1 Query: 91 VHYSPAEAVSSQSIVRHDQPQLHAAKLAVA-TPVAYHAAPVAYQADPVAYHAAPVATR 261 V Y P VR+ + +AV P+A P+A + P+A+ P+A R Sbjct: 264 VRYRPIAVRCRPIAVRYRPIAVRCRPIAVRYRPIAVRYRPIAVRYRPIAWRYRPIAVR 321 Score = 27.5 bits (58), Expect = 8.0 Identities = 16/58 (27%), Positives = 25/58 (43%), Gaps = 1/58 (1%) Frame = +1 Query: 91 VHYSPAEAVSSQSIVRHDQPQLHAAKLAVA-TPVAYHAAPVAYQADPVAYHAAPVATR 261 V Y P VR+ + +AV P+A P+A + P+A+ P+A R Sbjct: 376 VRYRPIAVRCRPIAVRYRPIAVRCRPIAVRYRPIAVRYRPIAVRYRPIAWRYRPIAVR 433 Score = 27.5 bits (58), Expect = 8.0 Identities = 17/58 (29%), Positives = 25/58 (43%), Gaps = 1/58 (1%) Frame = +1 Query: 91 VHYSPAEAVSSQSIVRHDQPQLHAAKLAVA-TPVAYHAAPVAYQADPVAYHAAPVATR 261 V Y P S VR+ + +AV P+A P+A + P+A P+A R Sbjct: 453 VRYRPIAVRYRPSAVRYRPIAVRYRPIAVRYRPIAVRYRPIAVRYRPIAVRYRPIAVR 510 >SB_19560| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 29.1 bits (62), Expect = 2.6 Identities = 17/57 (29%), Positives = 23/57 (40%), Gaps = 1/57 (1%) Frame = +3 Query: 183 PCSLPRGPCSVPGRPSCLPRGPCSYQAAPVAYHTSP-LRYSSAESGSFQNIVRHDQP 350 P S PCS P PCS P+ HT P L ++ G + + H +P Sbjct: 34 PRSATLAPCSATLAPCSATLAPCSALTCPMLGHTRPTLGHTRPTLGHTRPTLGHTRP 90 >SB_13377| Best HMM Match : Extensin_2 (HMM E-Value=0.00046) Length = 797 Score = 29.1 bits (62), Expect = 2.6 Identities = 29/97 (29%), Positives = 40/97 (41%), Gaps = 9/97 (9%) Frame = +1 Query: 91 VHYSPAEAVSSQSIVR-HDQPQLHAAKLAVATPVAYHA--APVAYQADPVAYHAA----P 249 VH+SP + + + R H P+ A TP H+ PV P +H+ P Sbjct: 560 VHHSPRTPLPAYTSPRVHHSPRTPVP--AYTTPRVLHSPRTPVPAYTSPRVHHSPRTPLP 617 Query: 250 VATRPP--QLPTTLLHSGTPRLNLARSKTSSVMTSPR 354 T P P T L + +PR L + T V SPR Sbjct: 618 AYTSPRVHHSPRTPLPAYSPRTTLPANTTPRVHHSPR 654 >SB_39921| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 210 Score = 28.7 bits (61), Expect = 3.5 Identities = 23/63 (36%), Positives = 28/63 (44%), Gaps = 2/63 (3%) Frame = +1 Query: 100 SPAE--AVSSQSIVRHDQPQLHAAKLAVATPVAYHAAPVAYQADPVAYHAAPVATRPPQL 273 +PAE AV + ++ A A P A AAP A A P A AAP AT + Sbjct: 13 APAETTAVPAGNMTAAPMETTAAPDATTAAPDATTAAPEATTAAPEATTAAPEATTAAPV 72 Query: 274 PTT 282 TT Sbjct: 73 ETT 75 >SB_48810| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 28.7 bits (61), Expect = 3.5 Identities = 19/40 (47%), Positives = 19/40 (47%), Gaps = 1/40 (2%) Frame = +3 Query: 75 TSGCSRALLSR*SRFFPK-HCAP*PASAPRCQARCCYPCS 191 TS SRA L F P HCA S PRC AR P S Sbjct: 18 TSPLSRAALRAYKAFHPVLHCALYKCSTPRCIARYTSPPS 57 >SB_29938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1008 Score = 28.3 bits (60), Expect = 4.6 Identities = 23/72 (31%), Positives = 32/72 (44%) Frame = +3 Query: 12 DPQHVLQNRSTVCFGRGVESWTSGCSRALLSR*SRFFPKHCAP*PASAPRCQARCCYPCS 191 DP+ V+ NR+ R + S CSR + RF+ H AP P R ++ P + Sbjct: 267 DPEDVIVNRNP----RSPLTVGSKCSRGTYIQRYRFYKSHSAPVPPETRRKRSLPGTP-N 321 Query: 192 LPRGPCSVPGRP 227 P GP RP Sbjct: 322 TPLGPHGRSVRP 333 >SB_25560| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 629 Score = 28.3 bits (60), Expect = 4.6 Identities = 15/38 (39%), Positives = 21/38 (55%) Frame = +1 Query: 241 AAPVATRPPQLPTTLLHSGTPRLNLARSKTSSVMTSPR 354 +AP TRPP LP +L G P R +SS+++ R Sbjct: 63 SAPGVTRPPSLPLSL---GIPSCCFVRCHSSSLLSESR 97 >SB_14763| Best HMM Match : Zona_pellucida (HMM E-Value=0) Length = 689 Score = 28.3 bits (60), Expect = 4.6 Identities = 16/37 (43%), Positives = 18/37 (48%), Gaps = 2/37 (5%) Frame = +3 Query: 147 ASAPRCQARCCY--PCSLPRGPCSVPGRPSCLPRGPC 251 AS + A C Y PCS G CSV G +C PC Sbjct: 2 ASCLQVTATCSYGNPCS-NGGSCSVDGSETCSNSNPC 37 >SB_53929| Best HMM Match : Amelogenin (HMM E-Value=3.6) Length = 156 Score = 27.9 bits (59), Expect = 6.1 Identities = 23/53 (43%), Positives = 24/53 (45%), Gaps = 7/53 (13%) Frame = +1 Query: 145 QPQLHAAKLAVATPVAYHAAPV---AYQADPVAYHAAPVA----TRPPQLPTT 282 + L AA A TP A AAPV A A PV AAP A T P P T Sbjct: 35 EASLTAASAAPVTPTAAPAAPVTPTAAPAAPVTPTAAPAARVTPTAAPAAPVT 87 Score = 27.5 bits (58), Expect = 8.0 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = +1 Query: 160 AAKLAVATPVAYHAAPVAYQADPVAYHAAPVATRPPQLPT 279 AA A TP A AAPV A P A A P PT Sbjct: 50 AAPAAPVTPTAAPAAPVTPTAAPAARVTPTAAPAAPVTPT 89 >SB_16587| Best HMM Match : Cytadhesin_P30 (HMM E-Value=0.69) Length = 404 Score = 27.9 bits (59), Expect = 6.1 Identities = 23/53 (43%), Positives = 24/53 (45%), Gaps = 7/53 (13%) Frame = +1 Query: 145 QPQLHAAKLAVATPVAYHAAPV---AYQADPVAYHAAPVA----TRPPQLPTT 282 + L AA A TP A AAPV A A PV AAP A T P P T Sbjct: 192 EASLTAASAAPVTPTAAPAAPVTPTAAPAAPVTPTAAPAARVTPTAAPAAPVT 244 Score = 27.5 bits (58), Expect = 8.0 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = +1 Query: 160 AAKLAVATPVAYHAAPVAYQADPVAYHAAPVATRPPQLPT 279 AA A TP A AAPV A P A A P PT Sbjct: 207 AAPAAPVTPTAAPAAPVTPTAAPAARVTPTAAPAAPVTPT 246 >SB_13048| Best HMM Match : Fork_head (HMM E-Value=0) Length = 311 Score = 27.9 bits (59), Expect = 6.1 Identities = 15/44 (34%), Positives = 22/44 (50%) Frame = +1 Query: 154 LHAAKLAVATPVAYHAAPVAYQADPVAYHAAPVATRPPQLPTTL 285 L+A ++ V Y + P A P + H P + PPQLP +L Sbjct: 190 LYATTYPISAYVPYFSPPHAIPRPP-SLHRDPPPSLPPQLPLSL 232 >SB_23501| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 585 Score = 27.5 bits (58), Expect = 8.0 Identities = 15/50 (30%), Positives = 18/50 (36%), Gaps = 1/50 (2%) Frame = +3 Query: 132 CAP*PASAPRCQARC-CYPCSLPRGPCSVPGRPSCLPRGPCSYQAAPVAY 278 C P +CQ Y C +G P R SC CS P +Y Sbjct: 127 CQTNPCGGAQCQNTLGSYYCGCAQGNILAPNRRSCQDINECSMGINPCSY 176 >SB_3877| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 27.5 bits (58), Expect = 8.0 Identities = 13/43 (30%), Positives = 18/43 (41%), Gaps = 2/43 (4%) Frame = +3 Query: 180 YPCSLPRGPCSVPGRPSCLPRGPCS--YQAAPVAYHTSPLRYS 302 + C LP C +P CLP C Y + Y+ L Y+ Sbjct: 27 HKCGLPYNECGLPYNKCCLPYTNCGLPYNKCGLPYNKCGLPYN 69 >SB_687| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 579 Score = 27.5 bits (58), Expect = 8.0 Identities = 16/34 (47%), Positives = 21/34 (61%), Gaps = 2/34 (5%) Frame = -1 Query: 118 KRLQRESSAR-EQPEVQLSTPR-PKHTVLRFWRT 23 KRL+ S AR EQP +STP+ KH V + +T Sbjct: 203 KRLRTNSQARSEQPVTPISTPKSSKHVVSKVGQT 236 >SB_56543| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1076 Score = 27.5 bits (58), Expect = 8.0 Identities = 18/59 (30%), Positives = 29/59 (49%) Frame = +1 Query: 91 VHYSPAEAVSSQSIVRHDQPQLHAAKLAVATPVAYHAAPVAYQADPVAYHAAPVATRPP 267 + + P E ++ + H QP H +A P+A H P+A+ P+A H P+A P Sbjct: 372 IPHGPHEPMAHIQPMAHIQPMAHIQPMAHIQPMA-HIQPMAH-IQPMA-HIQPMAHIQP 427 >SB_43809| Best HMM Match : PSGP (HMM E-Value=0.069) Length = 932 Score = 27.5 bits (58), Expect = 8.0 Identities = 28/98 (28%), Positives = 42/98 (42%), Gaps = 1/98 (1%) Frame = +1 Query: 58 AVSKAGLLAAPVHYSPAEAVSSQSIVRHDQPQLHAAKLAVATPVAYHAAPVAYQAD-PVA 234 A S A + A +P A S+ +I R+ PQ A+K A++T A + AD PV+ Sbjct: 741 ATSTATIPRATNTQAPKTASSANTIPRNTDPQ--ASKTAIST------ATIPRSADAPVS 792 Query: 235 YHAAPVATRPPQLPTTLLHSGTPRLNLARSKTSSVMTS 348 A AT P + + RS + V T+ Sbjct: 793 KQVASTATIPRSSDAQVPKQDASTATIPRSTDTQVSTT 830 >SB_40727| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1393 Score = 27.5 bits (58), Expect = 8.0 Identities = 16/59 (27%), Positives = 25/59 (42%) Frame = +1 Query: 175 VATPVAYHAAPVAYQADPVAYHAAPVATRPPQLPTTLLHSGTPRLNLARSKTSSVMTSP 351 + T P+A D P+AT P T L + TP L ++T+ + T+P Sbjct: 674 IKTSATTQTPPIASTTDTSTSQTPPIATTPSLTTQTTLIATTPSLT---TQTTLIATTP 729 >SB_18399| Best HMM Match : AMP-binding (HMM E-Value=0) Length = 1381 Score = 27.5 bits (58), Expect = 8.0 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 55 VAVSKAGLLAAPVHYSPAEAVSSQS 129 VAV K+ L +P PA AVSSQS Sbjct: 1081 VAVDKSSWLGSPPFLLPARAVSSQS 1105 >SB_6222| Best HMM Match : zf-C2H2 (HMM E-Value=7.6) Length = 177 Score = 27.5 bits (58), Expect = 8.0 Identities = 18/59 (30%), Positives = 29/59 (49%) Frame = +1 Query: 91 VHYSPAEAVSSQSIVRHDQPQLHAAKLAVATPVAYHAAPVAYQADPVAYHAAPVATRPP 267 + + P E ++ + H QP H +A P+A H P+A+ P+A H P+A P Sbjct: 58 IPHGPHEPMAHIQPMAHIQPMAHIQPMAHIQPMA-HIQPMAH-IQPMA-HIQPMAHIQP 113 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,939,347 Number of Sequences: 59808 Number of extensions: 265366 Number of successful extensions: 1116 Number of sequences better than 10.0: 32 Number of HSP's better than 10.0 without gapping: 750 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1058 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1325051197 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -