BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0263 (688 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC191.02c ||SPCC417.14c|acetyl-CoA ligase |Schizosaccharomyces... 26 4.4 SPAC15A10.11 |ubr11||N-end-recognizing protein |Schizosaccharomy... 26 5.9 SPBC6B1.07 |prp1|zer1|U4/U6 x U5 tri-snRNP complex subunit Prp1|... 26 5.9 >SPCC191.02c ||SPCC417.14c|acetyl-CoA ligase |Schizosaccharomyces pombe|chr 3|||Manual Length = 662 Score = 26.2 bits (55), Expect = 4.4 Identities = 13/57 (22%), Positives = 24/57 (42%) Frame = -1 Query: 373 GPPSSISVATPSGASFSRLWRARVTHHGTKWSSPKVMYCVVQHRKNDRLSADDGAFR 203 G + + +TP+ +SR W H T+W ++Q N+ + D + R Sbjct: 333 GAATLVFESTPAYPDYSRYWSVVERHRLTQWYIAPTAIRLLQRAGNEFVKHDRSSLR 389 >SPAC15A10.11 |ubr11||N-end-recognizing protein |Schizosaccharomyces pombe|chr 1|||Manual Length = 2052 Score = 25.8 bits (54), Expect = 5.9 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = +1 Query: 616 VKSTHFLTNRPKSAKSLINQKNRP 687 VK FLTN + SL+ Q NRP Sbjct: 675 VKDYDFLTNLNATTLSLLTQSNRP 698 >SPBC6B1.07 |prp1|zer1|U4/U6 x U5 tri-snRNP complex subunit Prp1|Schizosaccharomyces pombe|chr 2|||Manual Length = 906 Score = 25.8 bits (54), Expect = 5.9 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = -3 Query: 341 VWCFFFQIMARKGNPPRYKVVVT 273 VWC+F++ GN + K V+T Sbjct: 846 VWCWFYKYSLEAGNEDQQKEVLT 868 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,060,284 Number of Sequences: 5004 Number of extensions: 65748 Number of successful extensions: 145 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 143 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 145 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 317927284 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -