BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0263 (688 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) 95 6e-20 SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) 95 6e-20 SB_4159| Best HMM Match : Vpu (HMM E-Value=2) 95 6e-20 SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 7e-18 SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_17237| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_30142| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 7e-17 SB_43825| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 7e-17 SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 9e-17 SB_3496| Best HMM Match : Herpes_UL49_5 (HMM E-Value=7.2) 83 2e-16 SB_45641| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 3e-15 SB_36241| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_47433| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_50382| Best HMM Match : RVT_1 (HMM E-Value=0.026) 77 1e-14 SB_12310| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 2e-14 SB_3970| Best HMM Match : Drf_FH1 (HMM E-Value=1.2) 76 2e-14 SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) 75 4e-14 SB_52523| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_22658| Best HMM Match : Protamine_3 (HMM E-Value=9.6) 72 6e-14 SB_58792| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 7e-14 SB_55579| Best HMM Match : Rhodanese (HMM E-Value=9.2e-29) 75 7e-14 SB_50054| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 7e-14 SB_49806| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 7e-14 SB_47291| Best HMM Match : PilN (HMM E-Value=0.75) 75 7e-14 SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) 75 7e-14 SB_42949| Best HMM Match : SRCR (HMM E-Value=1.6e-14) 75 7e-14 SB_40068| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 75 7e-14 SB_36207| Best HMM Match : 7kD_coat (HMM E-Value=7.6) 75 7e-14 SB_31511| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 7e-14 SB_27897| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 7e-14 SB_27010| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 7e-14 SB_26995| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 7e-14 SB_20900| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 7e-14 SB_20814| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 7e-14 SB_15447| Best HMM Match : C1_1 (HMM E-Value=0.11) 75 7e-14 SB_14175| Best HMM Match : GBP_repeat (HMM E-Value=3.8) 75 7e-14 SB_8424| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 7e-14 SB_56358| Best HMM Match : Fork_head (HMM E-Value=1.2e-30) 75 7e-14 SB_56058| Best HMM Match : Phasin (HMM E-Value=2.7) 75 7e-14 SB_48632| Best HMM Match : DUF265 (HMM E-Value=7.6e-22) 75 7e-14 SB_46830| Best HMM Match : Succ_DH_flav_C (HMM E-Value=3.2e-37) 75 7e-14 SB_42128| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 7e-14 SB_40139| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 7e-14 SB_31293| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 7e-14 SB_30699| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 7e-14 SB_29464| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 7e-14 SB_25673| Best HMM Match : MFS_1 (HMM E-Value=0.18) 75 7e-14 SB_24724| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 7e-14 SB_17049| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 7e-14 SB_12580| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 7e-14 SB_11401| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 7e-14 SB_10689| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 7e-14 SB_9250| Best HMM Match : BAG (HMM E-Value=6.2) 75 7e-14 SB_32211| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 9e-14 SB_1214| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 9e-14 SB_41613| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 1e-13 SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 1e-13 SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_35997| Best HMM Match : Phage_fiber (HMM E-Value=0.78) 73 2e-13 SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_6796| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_39391| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) 73 3e-13 SB_44358| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_37661| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_15339| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_56871| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_55134| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 72 4e-13 SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 72 4e-13 SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_57634| Best HMM Match : EGF_2 (HMM E-Value=0.0014) 72 4e-13 SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_57287| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) 72 4e-13 SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) 72 4e-13 SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) 72 4e-13 SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) 72 4e-13 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) 72 4e-13 SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 72 4e-13 SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1) 72 4e-13 SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3) 72 4e-13 SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) 72 4e-13 SB_53980| Best HMM Match : UCR_TM (HMM E-Value=9.9) 72 4e-13 SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) 72 4e-13 SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_52260| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_52253| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_52086| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_51989| Best HMM Match : Extensin_2 (HMM E-Value=0.29) 72 4e-13 SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_51427| Best HMM Match : DUF855 (HMM E-Value=4) 72 4e-13 SB_51409| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_51320| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) 72 4e-13 SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_50493| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_50417| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_50270| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_49896| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_49839| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_49814| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_49530| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_49465| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_49395| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_49211| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_49150| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) 72 4e-13 SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_48522| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_48514| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_48486| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_48129| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_48100| Best HMM Match : Transformer (HMM E-Value=5.4) 72 4e-13 SB_48063| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_48045| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016) 72 4e-13 SB_47536| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_47480| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_47399| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_47276| Best HMM Match : DUF851 (HMM E-Value=9.6) 72 4e-13 SB_47213| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_46889| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) 72 4e-13 SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_46649| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_46589| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_46529| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_46517| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_46424| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_46412| Best HMM Match : HEAT (HMM E-Value=8) 72 4e-13 SB_46374| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_46344| Best HMM Match : ig (HMM E-Value=0.0082) 72 4e-13 SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) 72 4e-13 SB_46308| Best HMM Match : IMS (HMM E-Value=0) 72 4e-13 SB_46303| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_45887| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_45813| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_45524| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_45424| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_45381| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_45291| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_44920| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_44894| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_44806| Best HMM Match : Hist_deacetyl (HMM E-Value=0) 72 4e-13 SB_44800| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_44789| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) 72 4e-13 SB_44606| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_44466| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_44411| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_44401| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_44392| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_44259| Best HMM Match : MORN (HMM E-Value=3.7) 72 4e-13 SB_44076| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_44013| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_43970| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) 72 4e-13 SB_43909| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_43701| Best HMM Match : ubiquitin (HMM E-Value=0.003) 72 4e-13 SB_43671| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_43630| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_43618| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_43569| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_43145| Best HMM Match : PEGSRP (HMM E-Value=7.2) 72 4e-13 SB_43138| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.3e-14) 72 4e-13 SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_42990| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_42937| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_42936| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_42831| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) 72 4e-13 SB_42725| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_42655| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8) 72 4e-13 SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_42313| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_42158| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_42069| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_42015| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_41881| Best HMM Match : Extensin_1 (HMM E-Value=5.5) 72 4e-13 SB_41827| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_41806| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_41779| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_41728| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_41712| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_41568| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_41481| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_41365| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_41011| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_40939| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_40610| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_40566| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_40471| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_40462| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_40265| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_40240| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_40230| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_40107| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_39690| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_39438| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_39406| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_39373| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_39311| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_39201| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_39107| Best HMM Match : Lyase_8 (HMM E-Value=0.016) 72 4e-13 SB_38948| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_38916| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_38893| Best HMM Match : UMPH-1 (HMM E-Value=2.3e-21) 72 4e-13 SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) 72 4e-13 SB_38726| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_38504| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_38387| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_38141| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_38016| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_37962| Best HMM Match : Tcp10_C (HMM E-Value=5.9e-36) 72 4e-13 SB_37690| Best HMM Match : IgG_binding_B (HMM E-Value=4.2) 72 4e-13 SB_37635| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_37536| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_37412| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_37372| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9) 72 4e-13 SB_37147| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_37066| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_37038| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_37030| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_36958| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_36941| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_36865| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_36853| Best HMM Match : DNA_pol_B_exo (HMM E-Value=4.2) 72 4e-13 SB_36823| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_36358| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_35988| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_35856| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_35768| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_35732| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_35726| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_35698| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_35689| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_35635| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_35611| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_35484| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_35280| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) 72 4e-13 SB_35237| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_35223| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_35140| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_35136| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_35129| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_35057| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_35026| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_34829| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_34793| Best HMM Match : TIL (HMM E-Value=4.5) 72 4e-13 SB_34738| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_34683| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_34666| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_34501| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_34487| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_34462| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_34192| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_34190| Best HMM Match : MAM (HMM E-Value=0) 72 4e-13 SB_34054| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_34015| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_33934| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_33883| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_33752| Best HMM Match : I-set (HMM E-Value=3.7e-15) 72 4e-13 SB_33698| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_33625| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_33491| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_33475| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_33403| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_33369| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_33319| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_33270| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_33216| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_33186| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_32832| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_32674| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_32571| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_32529| Best HMM Match : Laminin_G_2 (HMM E-Value=0) 72 4e-13 SB_32525| Best HMM Match : DED (HMM E-Value=0.81) 72 4e-13 SB_32508| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_32440| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_32437| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_32426| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_32411| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_32339| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_32317| Best HMM Match : Cadherin (HMM E-Value=1.5e-28) 72 4e-13 SB_32310| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_32140| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_32110| Best HMM Match : PEGSRP (HMM E-Value=9.6) 72 4e-13 SB_31831| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_31818| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_31776| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_31757| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_31658| Best HMM Match : Arm (HMM E-Value=0.91) 72 4e-13 SB_31632| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_31490| Best HMM Match : Aa_trans (HMM E-Value=4.9e-31) 72 4e-13 SB_31476| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_31450| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_31401| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_31375| Best HMM Match : IQ (HMM E-Value=0.00076) 72 4e-13 SB_31367| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_31351| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_31291| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_31276| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_31227| Best HMM Match : RIO1 (HMM E-Value=0.13) 72 4e-13 SB_31127| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_31056| Best HMM Match : Virus_P-coat (HMM E-Value=6.4) 72 4e-13 SB_30978| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_30905| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_30849| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_30810| Best HMM Match : JmjC (HMM E-Value=0.0021) 72 4e-13 SB_30786| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_30644| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_30600| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_30578| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_30576| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_30457| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_30432| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_30415| Best HMM Match : M (HMM E-Value=6.5e-05) 72 4e-13 SB_30336| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_30192| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_29871| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_29660| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_29646| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_29445| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_29397| Best HMM Match : fn3 (HMM E-Value=0.038) 72 4e-13 SB_29341| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_29340| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_29332| Best HMM Match : PAN (HMM E-Value=0.039) 72 4e-13 SB_29330| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_29217| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_29207| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_29178| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_29126| Best HMM Match : FUN14 (HMM E-Value=1.8) 72 4e-13 SB_29104| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_29084| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_29039| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_29037| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_29000| Best HMM Match : DUF551 (HMM E-Value=2.2) 72 4e-13 SB_28961| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_28940| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_28922| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_28866| Best HMM Match : PhdYeFM (HMM E-Value=8.3) 72 4e-13 SB_28825| Best HMM Match : COX8 (HMM E-Value=4.5) 72 4e-13 SB_28717| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_28646| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_28582| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_28530| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_28324| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_28283| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_28269| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_28216| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_28148| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_28058| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_28014| Best HMM Match : HOOK (HMM E-Value=1.8e-13) 72 4e-13 SB_27927| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_27874| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_27823| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_27779| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_27762| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 >SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) Length = 2506 Score = 94.7 bits (225), Expect = 6e-20 Identities = 45/63 (71%), Positives = 46/63 (73%) Frame = -1 Query: 568 HSPFRLRNCWKGRSVRASSLYASWRKGDVLQGD*VG*RQGFPSHDVVKRRPVNCNTTHYR 389 HSPFRLRNCW+GRSVRASSL KG GFPSHDVVKRRPVNCNTTHYR Sbjct: 589 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRL---SWGFPSHDVVKRRPVNCNTTHYR 645 Query: 388 ANW 380 ANW Sbjct: 646 ANW 648 >SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) Length = 281 Score = 94.7 bits (225), Expect = 6e-20 Identities = 45/63 (71%), Positives = 46/63 (73%) Frame = -1 Query: 568 HSPFRLRNCWKGRSVRASSLYASWRKGDVLQGD*VG*RQGFPSHDVVKRRPVNCNTTHYR 389 HSPFRLRNCW+GRSVRASSL KG GFPSHDVVKRRPVNCNTTHYR Sbjct: 32 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRL---SWGFPSHDVVKRRPVNCNTTHYR 88 Query: 388 ANW 380 ANW Sbjct: 89 ANW 91 >SB_4159| Best HMM Match : Vpu (HMM E-Value=2) Length = 779 Score = 94.7 bits (225), Expect = 6e-20 Identities = 45/63 (71%), Positives = 46/63 (73%) Frame = -1 Query: 568 HSPFRLRNCWKGRSVRASSLYASWRKGDVLQGD*VG*RQGFPSHDVVKRRPVNCNTTHYR 389 HSPFRLRNCW+GRSVRASSL KG GFPSHDVVKRRPVNCNTTHYR Sbjct: 32 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRL---SWGFPSHDVVKRRPVNCNTTHYR 88 Query: 388 ANW 380 ANW Sbjct: 89 ANW 91 >SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 87.8 bits (208), Expect = 7e-18 Identities = 46/90 (51%), Positives = 53/90 (58%), Gaps = 1/90 (1%) Frame = -1 Query: 556 RLRNCWKGRSVRASSLYASWRKGDVLQGD*VG*RQGFPSHDVVKRRPVNCNTTHYRANW- 380 +LRNCW+GRSVRASSL KG GFPSHDVVKRRPVNCNTTHYRANW Sbjct: 22 QLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFPSHDVVKRRPVNCNTTHYRANWS 81 Query: 379 VPGPPSSISVATPSGASFSRLWRARVTHHG 290 +++ + P G S + VT G Sbjct: 82 STAVAAALELVDPPGCRNSIAGKNTVTQVG 111 >SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 87.4 bits (207), Expect = 1e-17 Identities = 39/42 (92%), Positives = 41/42 (97%) Frame = +2 Query: 383 IRPIVSRITIHWPSFYNVVTGKTLALPNLIALQHIPLSPAGV 508 +RP+VSRITIHW SFYNVVTGKTLALPNLIALQHIPLSPAGV Sbjct: 33 LRPVVSRITIHWTSFYNVVTGKTLALPNLIALQHIPLSPAGV 74 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/20 (90%), Positives = 19/20 (95%) Frame = +3 Query: 510 SEEARTDRPFQQLRSLNGEW 569 +EEARTDRP QQLRSLNGEW Sbjct: 76 AEEARTDRPSQQLRSLNGEW 95 >SB_17237| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 78 Score = 87.0 bits (206), Expect = 1e-17 Identities = 44/56 (78%), Positives = 48/56 (85%), Gaps = 1/56 (1%) Frame = -3 Query: 578 YNLPFAIQAAQLLE-RAIGAGLFAIRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 414 + PFAIQAAQLLE R++ A +RQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 HQAPFAIQAAQLLEGRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 62 >SB_30142| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 84.6 bits (200), Expect = 7e-17 Identities = 43/56 (76%), Positives = 47/56 (83%), Gaps = 1/56 (1%) Frame = -3 Query: 578 YNLPFAIQAAQLLE-RAIGAGLFAIRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 414 + PFAIQAAQL E R++ A +RQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 HQAPFAIQAAQLWEGRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 62 >SB_43825| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 84.6 bits (200), Expect = 7e-17 Identities = 43/56 (76%), Positives = 47/56 (83%), Gaps = 1/56 (1%) Frame = -3 Query: 578 YNLPFAIQAAQLLE-RAIGAGLFAIRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 414 + PFAIQAAQL E R++ A +RQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 HQAPFAIQAAQLWEGRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 62 >SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 84.2 bits (199), Expect = 9e-17 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +2 Query: 389 PIVSRITIHWPSFYNVVTGKTLALPNLIALQHIPLSPAGV*R 514 P +SRITIHWPSFYNVVTGKTLALPNLIALQHIPLSPAG+ R Sbjct: 77 PYMSRITIHWPSFYNVVTGKTLALPNLIALQHIPLSPAGLHR 118 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = +3 Query: 507 YSEEARTDRPFQQLRSLNGEW 569 + EEARTDRP QQLRSLNGEW Sbjct: 117 HREEARTDRPSQQLRSLNGEW 137 >SB_3496| Best HMM Match : Herpes_UL49_5 (HMM E-Value=7.2) Length = 98 Score = 83.0 bits (196), Expect = 2e-16 Identities = 38/42 (90%), Positives = 39/42 (92%) Frame = +2 Query: 398 SRITIHWPSFYNVVTGKTLALPNLIALQHIPLSPAGV*RRGP 523 SRITIHWPSFYNVVTGKTLALPNLIALQHIPLSPAGV + P Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALQHIPLSPAGVIAKRP 43 >SB_45641| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 82.2 bits (194), Expect = 4e-16 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = +2 Query: 398 SRITIHWPSFYNVVTGKTLALPNLIALQHIPLSPAGV 508 SRITIHWPSFYNVVTGKTLALPNLIALQHIPLSPAGV Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALQHIPLSPAGV 38 Score = 44.0 bits (99), Expect = 1e-04 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +3 Query: 510 SEEARTDRPFQQLRSLNGEW 569 SEEARTDRP QQLRSLNGEW Sbjct: 40 SEEARTDRPSQQLRSLNGEW 59 >SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 602 Score = 79.0 bits (186), Expect = 3e-15 Identities = 38/55 (69%), Positives = 44/55 (80%), Gaps = 3/55 (5%) Frame = -1 Query: 535 GRSVRAS--SLYASWRKGDVLQGD*-VG*RQGFPSHDVVKRRPVNCNTTHYRANW 380 GR++ A ++ + KGDVLQGD +G RQGFPSHDVVKRRPVNCNTTHYRANW Sbjct: 48 GRAIGAGLFAITPAGEKGDVLQGDLKLGKRQGFPSHDVVKRRPVNCNTTHYRANW 102 Score = 33.5 bits (73), Expect = 0.16 Identities = 17/24 (70%), Positives = 18/24 (75%) Frame = -3 Query: 557 QAAQLLERAIGAGLFAIRQLAKGG 486 QAAQLL RAIGAGLFAI + G Sbjct: 42 QAAQLLGRAIGAGLFAITPAGEKG 65 >SB_36241| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 100 Score = 78.2 bits (184), Expect = 6e-15 Identities = 36/47 (76%), Positives = 39/47 (82%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRIAKRPAPIALSNSCAA 555 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR ++ S+SCAA Sbjct: 54 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSHSCAA 100 >SB_47433| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 49 Score = 77.4 bits (182), Expect = 1e-14 Identities = 40/50 (80%), Positives = 43/50 (86%), Gaps = 1/50 (2%) Frame = -3 Query: 554 AAQLLE-RAIGAGLFAIRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 408 AAQL E R++ A +RQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 1 AAQLWEGRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 49 >SB_50382| Best HMM Match : RVT_1 (HMM E-Value=0.026) Length = 1036 Score = 77.4 bits (182), Expect = 1e-14 Identities = 40/70 (57%), Positives = 46/70 (65%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRIAKRPAPIALSNSCAA*MANGKL*ALIFC 594 LAVVLQRRDWENPGVTQLNRLAAHPPFASW P + L+ SC + ALI C Sbjct: 142 LAVVLQRRDWENPGVTQLNRLAAHPPFASWLENLSPLTVNLTGSCVSGPIRKNDLALITC 201 Query: 595 *NSR*IFVKS 624 + + I +S Sbjct: 202 PSEKYIVKQS 211 >SB_12310| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 76.2 bits (179), Expect = 2e-14 Identities = 35/47 (74%), Positives = 37/47 (78%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRIAKRPAPIALSNSCAA 555 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR ++ S CAA Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQCAA 75 >SB_3970| Best HMM Match : Drf_FH1 (HMM E-Value=1.2) Length = 558 Score = 76.2 bits (179), Expect = 2e-14 Identities = 35/47 (74%), Positives = 37/47 (78%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRIAKRPAPIALSNSCAA 555 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR ++ S CAA Sbjct: 512 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQCAA 558 >SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) Length = 234 Score = 75.4 bits (177), Expect = 4e-14 Identities = 39/69 (56%), Positives = 44/69 (63%), Gaps = 2/69 (2%) Frame = +1 Query: 307 LRAIIWKKKHQTASLPKCSRGGPVXXXXXXXXXXXXLA--VVLQRRDWENPGVTQLNRLA 480 L I+ +K + A+ +C G PV LA VVLQRRDWENPGVTQLNRLA Sbjct: 115 LLEIVKRKVIRKATCARCFAGWPVGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLA 174 Query: 481 AHPPFASWR 507 AHPPFASWR Sbjct: 175 AHPPFASWR 183 Score = 48.8 bits (111), Expect = 4e-06 Identities = 22/35 (62%), Positives = 26/35 (74%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEWQIVSVNIL 593 PF SEEARTDRP QQLRSLNGEW+++ +L Sbjct: 178 PFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 212 >SB_52523| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 498 Score = 74.9 bits (176), Expect = 5e-14 Identities = 39/61 (63%), Positives = 46/61 (75%) Frame = -3 Query: 590 NINAYNLPFAIQAAQLLERAIGAGLFAIRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE 411 N+ A + PF ++ R++ A +RQLAKGGCAARRLSWVTPGFSQSRRCKTTASE Sbjct: 440 NMGASHSPFRLRNCWE-GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE 497 Query: 410 L 408 L Sbjct: 498 L 498 >SB_22658| Best HMM Match : Protamine_3 (HMM E-Value=9.6) Length = 128 Score = 72.1 bits (169), Expect(2) = 6e-14 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 73 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 103 Score = 48.4 bits (110), Expect = 5e-06 Identities = 21/30 (70%), Positives = 24/30 (80%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEWQIV 578 PF SEEARTDRP QQLRSLNGEW+++ Sbjct: 98 PFASWRNSEEARTDRPSQQLRSLNGEWRLM 127 Score = 23.0 bits (47), Expect(2) = 6e-14 Identities = 12/41 (29%), Positives = 20/41 (48%) Frame = +1 Query: 172 HEFKEGDWAVAEMRRHPLKGDRSFYAELHNTSLLVTTTLYR 294 H ++ G A+ E+RR+ GD + + SL + L R Sbjct: 40 HRYRPGTVALREIRRYQKSGD-PLESTCRHASLALAVVLQR 79 >SB_58792| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 74.5 bits (175), Expect = 7e-14 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -3 Query: 509 IRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 408 +RQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 24 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 Score = 49.2 bits (112), Expect = 3e-06 Identities = 21/27 (77%), Positives = 22/27 (81%) Frame = -1 Query: 568 HSPFRLRNCWKGRSVRASSLYASWRKG 488 HSPFRLRNCW+GRSVRASSL KG Sbjct: 4 HSPFRLRNCWEGRSVRASSLLRQLAKG 30 >SB_55579| Best HMM Match : Rhodanese (HMM E-Value=9.2e-29) Length = 269 Score = 74.5 bits (175), Expect = 7e-14 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -3 Query: 509 IRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 408 +RQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 236 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 269 Score = 49.2 bits (112), Expect = 3e-06 Identities = 21/27 (77%), Positives = 22/27 (81%) Frame = -1 Query: 568 HSPFRLRNCWKGRSVRASSLYASWRKG 488 HSPFRLRNCW+GRSVRASSL KG Sbjct: 216 HSPFRLRNCWEGRSVRASSLLRQLAKG 242 >SB_50054| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 937 Score = 74.5 bits (175), Expect = 7e-14 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -3 Query: 509 IRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 408 +RQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 904 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 937 Score = 37.5 bits (83), Expect = 0.010 Identities = 16/23 (69%), Positives = 18/23 (78%) Frame = -1 Query: 556 RLRNCWKGRSVRASSLYASWRKG 488 +LRNCW+GRSVRASSL KG Sbjct: 888 QLRNCWEGRSVRASSLLRQLAKG 910 >SB_49806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 74.5 bits (175), Expect = 7e-14 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -3 Query: 509 IRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 408 +RQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 17 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 50 Score = 37.1 bits (82), Expect = 0.013 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = -1 Query: 553 LRNCWKGRSVRASSLYASWRKG 488 LRNCW+GRSVRASSL KG Sbjct: 2 LRNCWEGRSVRASSLLRQLAKG 23 >SB_47291| Best HMM Match : PilN (HMM E-Value=0.75) Length = 424 Score = 74.5 bits (175), Expect = 7e-14 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -3 Query: 509 IRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 408 +RQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 391 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 424 Score = 49.2 bits (112), Expect = 3e-06 Identities = 21/27 (77%), Positives = 22/27 (81%) Frame = -1 Query: 568 HSPFRLRNCWKGRSVRASSLYASWRKG 488 HSPFRLRNCW+GRSVRASSL KG Sbjct: 371 HSPFRLRNCWEGRSVRASSLLRQLAKG 397 >SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) Length = 273 Score = 74.5 bits (175), Expect = 7e-14 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -3 Query: 509 IRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 408 +RQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 240 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 273 Score = 37.9 bits (84), Expect = 0.008 Identities = 16/23 (69%), Positives = 18/23 (78%) Frame = -1 Query: 556 RLRNCWKGRSVRASSLYASWRKG 488 +LRNCW+GRSVRASSL KG Sbjct: 224 KLRNCWEGRSVRASSLLRQLAKG 246 >SB_42949| Best HMM Match : SRCR (HMM E-Value=1.6e-14) Length = 340 Score = 74.5 bits (175), Expect = 7e-14 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -3 Query: 509 IRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 408 +RQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 307 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 340 Score = 49.2 bits (112), Expect = 3e-06 Identities = 21/27 (77%), Positives = 22/27 (81%) Frame = -1 Query: 568 HSPFRLRNCWKGRSVRASSLYASWRKG 488 HSPFRLRNCW+GRSVRASSL KG Sbjct: 287 HSPFRLRNCWEGRSVRASSLLRQLAKG 313 >SB_40068| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 406 Score = 74.5 bits (175), Expect = 7e-14 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -3 Query: 509 IRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 408 +RQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 373 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 406 Score = 37.1 bits (82), Expect = 0.013 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = -1 Query: 553 LRNCWKGRSVRASSLYASWRKG 488 LRNCW+GRSVRASSL KG Sbjct: 358 LRNCWEGRSVRASSLLRQLAKG 379 >SB_36207| Best HMM Match : 7kD_coat (HMM E-Value=7.6) Length = 98 Score = 74.5 bits (175), Expect = 7e-14 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -3 Query: 509 IRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 408 +RQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 65 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 98 Score = 45.6 bits (103), Expect = 4e-05 Identities = 22/41 (53%), Positives = 26/41 (63%) Frame = -1 Query: 610 FNANFNKILTLTICHSPFRLRNCWKGRSVRASSLYASWRKG 488 F F+++ HSPFRLRNC +GRSVRASSL KG Sbjct: 31 FAIAFHRLKNQGASHSPFRLRNCGEGRSVRASSLLRQLAKG 71 >SB_31511| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 372 Score = 74.5 bits (175), Expect = 7e-14 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -3 Query: 509 IRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 408 +RQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 24 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 Score = 49.2 bits (112), Expect = 3e-06 Identities = 21/27 (77%), Positives = 22/27 (81%) Frame = -1 Query: 568 HSPFRLRNCWKGRSVRASSLYASWRKG 488 HSPFRLRNCW+GRSVRASSL KG Sbjct: 4 HSPFRLRNCWEGRSVRASSLLRQLAKG 30 >SB_27897| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 74.5 bits (175), Expect = 7e-14 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -3 Query: 509 IRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 408 +RQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 17 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 50 Score = 37.1 bits (82), Expect = 0.013 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = -1 Query: 553 LRNCWKGRSVRASSLYASWRKG 488 LRNCW+GRSVRASSL KG Sbjct: 2 LRNCWEGRSVRASSLLRQLAKG 23 >SB_27010| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 74.5 bits (175), Expect = 7e-14 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -3 Query: 509 IRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 408 +RQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 17 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 50 Score = 37.1 bits (82), Expect = 0.013 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = -1 Query: 553 LRNCWKGRSVRASSLYASWRKG 488 LRNCW+GRSVRASSL KG Sbjct: 2 LRNCWEGRSVRASSLLRQLAKG 23 >SB_26995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 74.5 bits (175), Expect = 7e-14 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -3 Query: 509 IRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 408 +RQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 24 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 Score = 49.2 bits (112), Expect = 3e-06 Identities = 21/27 (77%), Positives = 22/27 (81%) Frame = -1 Query: 568 HSPFRLRNCWKGRSVRASSLYASWRKG 488 HSPFRLRNCW+GRSVRASSL KG Sbjct: 4 HSPFRLRNCWEGRSVRASSLLRQLAKG 30 >SB_20900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 74.5 bits (175), Expect = 7e-14 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -3 Query: 509 IRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 408 +RQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 24 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 Score = 49.2 bits (112), Expect = 3e-06 Identities = 21/27 (77%), Positives = 22/27 (81%) Frame = -1 Query: 568 HSPFRLRNCWKGRSVRASSLYASWRKG 488 HSPFRLRNCW+GRSVRASSL KG Sbjct: 4 HSPFRLRNCWEGRSVRASSLLRQLAKG 30 >SB_20814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 74.5 bits (175), Expect = 7e-14 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -3 Query: 509 IRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 408 +RQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 47 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 80 Score = 49.2 bits (112), Expect = 3e-06 Identities = 21/27 (77%), Positives = 22/27 (81%) Frame = -1 Query: 568 HSPFRLRNCWKGRSVRASSLYASWRKG 488 HSPFRLRNCW+GRSVRASSL KG Sbjct: 27 HSPFRLRNCWEGRSVRASSLLRQLAKG 53 >SB_15447| Best HMM Match : C1_1 (HMM E-Value=0.11) Length = 316 Score = 74.5 bits (175), Expect = 7e-14 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -3 Query: 509 IRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 408 +RQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 283 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 316 Score = 39.1 bits (87), Expect = 0.003 Identities = 17/23 (73%), Positives = 18/23 (78%) Frame = -1 Query: 556 RLRNCWKGRSVRASSLYASWRKG 488 RLRNCW+GRSVRASSL KG Sbjct: 267 RLRNCWEGRSVRASSLLRQLAKG 289 >SB_14175| Best HMM Match : GBP_repeat (HMM E-Value=3.8) Length = 300 Score = 74.5 bits (175), Expect = 7e-14 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -3 Query: 509 IRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 408 +RQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 267 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 300 Score = 37.9 bits (84), Expect = 0.008 Identities = 16/23 (69%), Positives = 18/23 (78%) Frame = -1 Query: 556 RLRNCWKGRSVRASSLYASWRKG 488 +LRNCW+GRSVRASSL KG Sbjct: 251 KLRNCWEGRSVRASSLLRQLAKG 273 >SB_8424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 74.5 bits (175), Expect = 7e-14 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -3 Query: 509 IRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 408 +RQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 17 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 50 Score = 37.1 bits (82), Expect = 0.013 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = -1 Query: 553 LRNCWKGRSVRASSLYASWRKG 488 LRNCW+GRSVRASSL KG Sbjct: 2 LRNCWEGRSVRASSLLRQLAKG 23 >SB_56358| Best HMM Match : Fork_head (HMM E-Value=1.2e-30) Length = 289 Score = 74.5 bits (175), Expect = 7e-14 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -3 Query: 509 IRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 408 +RQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 256 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 289 Score = 41.1 bits (92), Expect = 8e-04 Identities = 18/27 (66%), Positives = 19/27 (70%) Frame = -1 Query: 568 HSPFRLRNCWKGRSVRASSLYASWRKG 488 H RLRNCW+GRSVRASSL KG Sbjct: 236 HLTIRLRNCWEGRSVRASSLLRQLAKG 262 >SB_56058| Best HMM Match : Phasin (HMM E-Value=2.7) Length = 314 Score = 74.5 bits (175), Expect = 7e-14 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -3 Query: 509 IRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 408 +RQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 281 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 314 Score = 49.2 bits (112), Expect = 3e-06 Identities = 21/27 (77%), Positives = 22/27 (81%) Frame = -1 Query: 568 HSPFRLRNCWKGRSVRASSLYASWRKG 488 HSPFRLRNCW+GRSVRASSL KG Sbjct: 261 HSPFRLRNCWEGRSVRASSLLRQLAKG 287 >SB_48632| Best HMM Match : DUF265 (HMM E-Value=7.6e-22) Length = 455 Score = 74.5 bits (175), Expect = 7e-14 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -3 Query: 509 IRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 408 +RQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 134 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 167 Score = 37.1 bits (82), Expect = 0.013 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = -1 Query: 553 LRNCWKGRSVRASSLYASWRKG 488 LRNCW+GRSVRASSL KG Sbjct: 119 LRNCWEGRSVRASSLLRQLAKG 140 >SB_46830| Best HMM Match : Succ_DH_flav_C (HMM E-Value=3.2e-37) Length = 333 Score = 74.5 bits (175), Expect = 7e-14 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -3 Query: 509 IRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 408 +RQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 300 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 333 Score = 49.2 bits (112), Expect = 3e-06 Identities = 21/27 (77%), Positives = 22/27 (81%) Frame = -1 Query: 568 HSPFRLRNCWKGRSVRASSLYASWRKG 488 HSPFRLRNCW+GRSVRASSL KG Sbjct: 280 HSPFRLRNCWEGRSVRASSLLRQLAKG 306 >SB_42128| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 74.5 bits (175), Expect = 7e-14 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -3 Query: 509 IRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 408 +RQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 150 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 183 Score = 49.2 bits (112), Expect = 3e-06 Identities = 21/27 (77%), Positives = 22/27 (81%) Frame = -1 Query: 568 HSPFRLRNCWKGRSVRASSLYASWRKG 488 HSPFRLRNCW+GRSVRASSL KG Sbjct: 130 HSPFRLRNCWEGRSVRASSLLRQLAKG 156 >SB_40139| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 74.5 bits (175), Expect = 7e-14 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -3 Query: 509 IRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 408 +RQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 24 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 Score = 49.2 bits (112), Expect = 3e-06 Identities = 21/27 (77%), Positives = 22/27 (81%) Frame = -1 Query: 568 HSPFRLRNCWKGRSVRASSLYASWRKG 488 HSPFRLRNCW+GRSVRASSL KG Sbjct: 4 HSPFRLRNCWEGRSVRASSLLRQLAKG 30 >SB_31293| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 74.5 bits (175), Expect = 7e-14 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -3 Query: 509 IRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 408 +RQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 24 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 Score = 49.2 bits (112), Expect = 3e-06 Identities = 21/27 (77%), Positives = 22/27 (81%) Frame = -1 Query: 568 HSPFRLRNCWKGRSVRASSLYASWRKG 488 HSPFRLRNCW+GRSVRASSL KG Sbjct: 4 HSPFRLRNCWEGRSVRASSLLRQLAKG 30 >SB_30699| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 43 Score = 74.5 bits (175), Expect = 7e-14 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -3 Query: 509 IRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 408 +RQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 10 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 43 >SB_29464| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 242 Score = 74.5 bits (175), Expect = 7e-14 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -3 Query: 509 IRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 408 +RQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 209 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 242 Score = 37.9 bits (84), Expect = 0.008 Identities = 16/23 (69%), Positives = 18/23 (78%) Frame = -1 Query: 556 RLRNCWKGRSVRASSLYASWRKG 488 +LRNCW+GRSVRASSL KG Sbjct: 193 KLRNCWEGRSVRASSLLRQLAKG 215 >SB_25673| Best HMM Match : MFS_1 (HMM E-Value=0.18) Length = 634 Score = 74.5 bits (175), Expect = 7e-14 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -3 Query: 509 IRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 408 +RQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 601 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 634 Score = 49.2 bits (112), Expect = 3e-06 Identities = 21/27 (77%), Positives = 22/27 (81%) Frame = -1 Query: 568 HSPFRLRNCWKGRSVRASSLYASWRKG 488 HSPFRLRNCW+GRSVRASSL KG Sbjct: 581 HSPFRLRNCWEGRSVRASSLLRQLAKG 607 >SB_24724| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2021 Score = 74.5 bits (175), Expect = 7e-14 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -3 Query: 509 IRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 408 +RQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 237 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 270 Score = 37.9 bits (84), Expect = 0.008 Identities = 16/23 (69%), Positives = 18/23 (78%) Frame = -1 Query: 556 RLRNCWKGRSVRASSLYASWRKG 488 +LRNCW+GRSVRASSL KG Sbjct: 221 KLRNCWEGRSVRASSLLRQLAKG 243 >SB_17049| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 548 Score = 74.5 bits (175), Expect = 7e-14 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -3 Query: 509 IRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 408 +RQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 515 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 548 Score = 49.2 bits (112), Expect = 3e-06 Identities = 21/27 (77%), Positives = 22/27 (81%) Frame = -1 Query: 568 HSPFRLRNCWKGRSVRASSLYASWRKG 488 HSPFRLRNCW+GRSVRASSL KG Sbjct: 495 HSPFRLRNCWEGRSVRASSLLRQLAKG 521 >SB_12580| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 74.5 bits (175), Expect = 7e-14 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -3 Query: 509 IRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 408 +RQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 98 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 131 Score = 37.1 bits (82), Expect = 0.013 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = -1 Query: 553 LRNCWKGRSVRASSLYASWRKG 488 LRNCW+GRSVRASSL KG Sbjct: 83 LRNCWEGRSVRASSLLRQLAKG 104 >SB_11401| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 439 Score = 74.5 bits (175), Expect = 7e-14 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -3 Query: 509 IRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 408 +RQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 406 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 439 Score = 39.1 bits (87), Expect = 0.003 Identities = 17/23 (73%), Positives = 18/23 (78%) Frame = -1 Query: 556 RLRNCWKGRSVRASSLYASWRKG 488 RLRNCW+GRSVRASSL KG Sbjct: 390 RLRNCWEGRSVRASSLLRQLAKG 412 >SB_10689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 43 Score = 74.5 bits (175), Expect = 7e-14 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -3 Query: 509 IRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 408 +RQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 10 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 43 >SB_9250| Best HMM Match : BAG (HMM E-Value=6.2) Length = 232 Score = 74.5 bits (175), Expect = 7e-14 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -3 Query: 509 IRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 408 +RQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 199 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 232 Score = 49.2 bits (112), Expect = 3e-06 Identities = 21/27 (77%), Positives = 22/27 (81%) Frame = -1 Query: 568 HSPFRLRNCWKGRSVRASSLYASWRKG 488 HSPFRLRNCW+GRSVRASSL KG Sbjct: 179 HSPFRLRNCWEGRSVRASSLLRQLAKG 205 >SB_32211| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 109 Score = 74.1 bits (174), Expect = 9e-14 Identities = 33/37 (89%), Positives = 34/37 (91%) Frame = +2 Query: 413 HWPSFYNVVTGKTLALPNLIALQHIPLSPAGV*RRGP 523 HWPSFYNVVTGKTLALPNLIALQHIPLSPAGV + P Sbjct: 62 HWPSFYNVVTGKTLALPNLIALQHIPLSPAGVIAKRP 98 Score = 33.9 bits (74), Expect = 0.12 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = +1 Query: 508 IAKRPAPIALSNSCAA 555 IAKRPAPIAL NSCAA Sbjct: 94 IAKRPAPIALPNSCAA 109 >SB_1214| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 74.1 bits (174), Expect = 9e-14 Identities = 33/37 (89%), Positives = 34/37 (91%) Frame = +2 Query: 413 HWPSFYNVVTGKTLALPNLIALQHIPLSPAGV*RRGP 523 HWPSFYNVVTGKTLALPNLIALQHIPLSPAGV + P Sbjct: 57 HWPSFYNVVTGKTLALPNLIALQHIPLSPAGVIAKRP 93 Score = 33.9 bits (74), Expect = 0.12 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = +1 Query: 508 IAKRPAPIALSNSCAA 555 IAKRPAPIAL NSCAA Sbjct: 89 IAKRPAPIALPNSCAA 104 >SB_41613| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 49 Score = 73.7 bits (173), Expect = 1e-13 Identities = 39/50 (78%), Positives = 42/50 (84%), Gaps = 1/50 (2%) Frame = -3 Query: 554 AAQLLE-RAIGAGLFAIRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 408 AAQL E R++ A +RQLAKGGCAARRLSWVTP FSQSRRCKTTASEL Sbjct: 1 AAQLWEGRSVRASSL-LRQLAKGGCAARRLSWVTPVFSQSRRCKTTASEL 49 >SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 73.7 bits (173), Expect = 1e-13 Identities = 34/39 (87%), Positives = 35/39 (89%) Frame = -3 Query: 509 IRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL*YDSL 393 +RQLAKGGCAARRLSWVTPGFSQSRRCKTTASE D L Sbjct: 24 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEFPGDPL 62 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 85 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 115 Score = 49.2 bits (112), Expect = 3e-06 Identities = 21/27 (77%), Positives = 22/27 (81%) Frame = -1 Query: 568 HSPFRLRNCWKGRSVRASSLYASWRKG 488 HSPFRLRNCW+GRSVRASSL KG Sbjct: 4 HSPFRLRNCWEGRSVRASSLLRQLAKG 30 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEW 569 PF SEEARTDRP QQLRSLNGEW Sbjct: 110 PFASWRNSEEARTDRPSQQLRSLNGEW 136 >SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 72.9 bits (171), Expect = 2e-13 Identities = 39/69 (56%), Positives = 44/69 (63%) Frame = +1 Query: 301 LPLRAIIWKKKHQTASLPKCSRGGPVXXXXXXXXXXXXLAVVLQRRDWENPGVTQLNRLA 480 LPL + ++ + A L RG P+ LAVVLQRRDWENPGVTQLNRLA Sbjct: 54 LPLPTLFYQP--EAAHLGDLLRGDPLESTCRHASLA--LAVVLQRRDWENPGVTQLNRLA 109 Query: 481 AHPPFASWR 507 AHPPFASWR Sbjct: 110 AHPPFASWR 118 Score = 48.8 bits (111), Expect = 4e-06 Identities = 22/35 (62%), Positives = 26/35 (74%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEWQIVSVNIL 593 PF SEEARTDRP QQLRSLNGEW+++ +L Sbjct: 113 PFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 147 >SB_35997| Best HMM Match : Phage_fiber (HMM E-Value=0.78) Length = 197 Score = 72.9 bits (171), Expect = 2e-13 Identities = 38/59 (64%), Positives = 41/59 (69%) Frame = +1 Query: 331 KHQTASLPKCSRGGPVXXXXXXXXXXXXLAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 +H T +LP S G P+ LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 91 QHLT-TLPLSSPGDPLESTCRHASLA--LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 146 Score = 48.8 bits (111), Expect = 4e-06 Identities = 22/35 (62%), Positives = 26/35 (74%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEWQIVSVNIL 593 PF SEEARTDRP QQLRSLNGEW+++ +L Sbjct: 141 PFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 175 >SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 72.9 bits (171), Expect = 2e-13 Identities = 31/37 (83%), Positives = 32/37 (86%) Frame = -2 Query: 552 CATVGKGDRCGPLRYTPAGERGMCCKAIKLGNARVFP 442 CATVGKGDRCG TPAGERGMCCKAIKLGNA+ FP Sbjct: 2 CATVGKGDRCGLFAITPAGERGMCCKAIKLGNAKGFP 38 Score = 62.9 bits (146), Expect = 2e-10 Identities = 25/29 (86%), Positives = 27/29 (93%) Frame = -1 Query: 466 VG*RQGFPSHDVVKRRPVNCNTTHYRANW 380 +G +GFPSHDVVKRRPVNCNTTHYRANW Sbjct: 31 LGNAKGFPSHDVVKRRPVNCNTTHYRANW 59 >SB_6796| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 925 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = -3 Query: 509 IRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE 411 +RQLAKGGCAARRLSWVTPGFSQSRRCKTTASE Sbjct: 546 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE 578 Score = 39.1 bits (87), Expect = 0.003 Identities = 17/23 (73%), Positives = 18/23 (78%) Frame = -1 Query: 556 RLRNCWKGRSVRASSLYASWRKG 488 RLRNCW+GRSVRASSL KG Sbjct: 530 RLRNCWEGRSVRASSLLRQLAKG 552 >SB_39391| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 376 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = -3 Query: 509 IRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 408 +RQL KGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 343 LRQLVKGGCAARRLSWVTPGFSQSRRCKTTASEL 376 >SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 917 Score = 72.5 bits (170), Expect = 3e-13 Identities = 36/51 (70%), Positives = 37/51 (72%) Frame = +1 Query: 355 KCSRGGPVXXXXXXXXXXXXLAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 K SRG P+ LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 815 KPSRGDPLESTCRHASLA--LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 863 Score = 49.2 bits (112), Expect = 3e-06 Identities = 23/40 (57%), Positives = 27/40 (67%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEWQIVSVNILLKFAL 608 PF SEEARTDRP QQLRSLNGEW+++ +L L Sbjct: 858 PFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLLTHLIL 897 >SB_44358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 72.5 bits (170), Expect = 3e-13 Identities = 36/54 (66%), Positives = 38/54 (70%) Frame = +1 Query: 346 SLPKCSRGGPVXXXXXXXXXXXXLAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 SL +RG P+ LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 75 SLHNSTRGDPLESTCRHASLA--LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 126 Score = 48.8 bits (111), Expect = 4e-06 Identities = 22/35 (62%), Positives = 26/35 (74%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEWQIVSVNIL 593 PF SEEARTDRP QQLRSLNGEW+++ +L Sbjct: 121 PFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 155 >SB_37661| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 397 Score = 72.5 bits (170), Expect = 3e-13 Identities = 41/94 (43%), Positives = 49/94 (52%) Frame = +1 Query: 226 KGDRSFYAELHNTSLLVTTTLYRGGLPLRAIIWKKKHQTASLPKCSRGGPVXXXXXXXXX 405 K D FYA+ +++T + L + +K + S C Sbjct: 107 KSDLFFYAKYMFLRTVMSTNKRKNFLGRAFELAAEKTKARSTHDCFDPAGDPLESTCRHA 166 Query: 406 XXXLAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 167 SLALAVVLQRRDWENPGVTQLNRLAAHPPFASWR 200 Score = 48.4 bits (110), Expect = 5e-06 Identities = 21/30 (70%), Positives = 24/30 (80%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEWQIV 578 PF SEEARTDRP QQLRSLNGEW+++ Sbjct: 195 PFASWRNSEEARTDRPSQQLRSLNGEWRLM 224 >SB_15339| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 214 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/35 (88%), Positives = 34/35 (97%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRIAKR 519 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR +++ Sbjct: 123 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEK 157 Score = 45.2 bits (102), Expect = 5e-05 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEW 569 PF SE+ARTDRP QQLRSLNGEW Sbjct: 148 PFASWRNSEKARTDRPSQQLRSLNGEW 174 >SB_56871| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 311 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRIAK 516 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR ++ Sbjct: 220 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRTSE 253 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEW 569 PF SEEARTDRP QQLRSLNGEW Sbjct: 245 PFASWRTSEEARTDRPSQQLRSLNGEW 271 >SB_55134| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 72.5 bits (170), Expect = 3e-13 Identities = 31/35 (88%), Positives = 34/35 (97%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRIAKR 519 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR +++ Sbjct: 58 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEK 92 Score = 45.2 bits (102), Expect = 5e-05 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEW 569 PF SE+ARTDRP QQLRSLNGEW Sbjct: 83 PFASWRNSEKARTDRPSQQLRSLNGEW 109 >SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 35 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 65 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEW 569 PF SEEARTDRP QQLRSLNGEW Sbjct: 60 PFASWRNSEEARTDRPSQQLRSLNGEW 86 >SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 59 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEW 569 PF SEEARTDRP QQLRSLNGEW Sbjct: 54 PFASWRNSEEARTDRPSQQLRSLNGEW 80 >SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 62 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 92 Score = 48.8 bits (111), Expect = 4e-06 Identities = 22/35 (62%), Positives = 26/35 (74%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEWQIVSVNIL 593 PF SEEARTDRP QQLRSLNGEW+++ +L Sbjct: 87 PFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 121 >SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 44 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 74 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEW 569 PF SEEARTDRP QQLRSLNGEW Sbjct: 69 PFASWRNSEEARTDRPSQQLRSLNGEW 95 >SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 36 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 66 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEW 569 PF SEEARTDRP QQLRSLNGEW Sbjct: 61 PFASWRNSEEARTDRPSQQLRSLNGEW 87 >SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 62 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 92 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEW 569 PF SEEARTDRP QQLRSLNGEW Sbjct: 87 PFASWRNSEEARTDRPSQQLRSLNGEW 113 >SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 67 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 97 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEW 569 PF SEEARTDRP QQLRSLNGEW Sbjct: 92 PFASWRNSEEARTDRPSQQLRSLNGEW 118 >SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 38 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 68 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEW 569 PF SEEARTDRP QQLRSLNGEW Sbjct: 63 PFASWRNSEEARTDRPSQQLRSLNGEW 89 >SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 58 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 88 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEW 569 PF SEEARTDRP QQLRSLNGEW Sbjct: 83 PFASWRNSEEARTDRPSQQLRSLNGEW 109 >SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 161 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 70 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 100 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEW 569 PF SEEARTDRP QQLRSLNGEW Sbjct: 95 PFASWRNSEEARTDRPSQQLRSLNGEW 121 >SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 59 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEW 569 PF SEEARTDRP QQLRSLNGEW Sbjct: 54 PFASWRNSEEARTDRPSQQLRSLNGEW 80 >SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 46 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 76 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEW 569 PF SEEARTDRP QQLRSLNGEW Sbjct: 71 PFASWRNSEEARTDRPSQQLRSLNGEW 97 >SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 35 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 65 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEW 569 PF SEEARTDRP QQLRSLNGEW Sbjct: 60 PFASWRNSEEARTDRPSQQLRSLNGEW 86 >SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 25 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 55 Score = 48.8 bits (111), Expect = 4e-06 Identities = 22/35 (62%), Positives = 26/35 (74%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEWQIVSVNIL 593 PF SEEARTDRP QQLRSLNGEW+++ +L Sbjct: 50 PFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 84 >SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 50 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 80 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEW 569 PF SEEARTDRP QQLRSLNGEW Sbjct: 75 PFASWRNSEEARTDRPSQQLRSLNGEW 101 >SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 59 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 89 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEW 569 PF SEEARTDRP QQLRSLNGEW Sbjct: 84 PFASWRNSEEARTDRPSQQLRSLNGEW 110 >SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 53 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 83 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEW 569 PF SEEARTDRP QQLRSLNGEW Sbjct: 78 PFASWRNSEEARTDRPSQQLRSLNGEW 104 >SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 69 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 99 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEW 569 PF SEEARTDRP QQLRSLNGEW Sbjct: 94 PFASWRNSEEARTDRPSQQLRSLNGEW 120 >SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 57 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 87 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEW 569 PF SEEARTDRP QQLRSLNGEW Sbjct: 82 PFASWRNSEEARTDRPSQQLRSLNGEW 108 >SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 40 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 70 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEW 569 PF SEEARTDRP QQLRSLNGEW Sbjct: 65 PFASWRNSEEARTDRPSQQLRSLNGEW 91 >SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) Length = 297 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 216 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 246 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEW 569 PF SEEARTDRP QQLRSLNGEW Sbjct: 241 PFASWRNSEEARTDRPSQQLRSLNGEW 267 >SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 111 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 141 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEW 569 PF SEEARTDRP QQLRSLNGEW Sbjct: 136 PFASWRNSEEARTDRPSQQLRSLNGEW 162 >SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 49 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 79 Score = 48.8 bits (111), Expect = 4e-06 Identities = 22/35 (62%), Positives = 26/35 (74%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEWQIVSVNIL 593 PF SEEARTDRP QQLRSLNGEW+++ +L Sbjct: 74 PFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 108 >SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 28 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 58 Score = 48.8 bits (111), Expect = 4e-06 Identities = 22/35 (62%), Positives = 26/35 (74%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEWQIVSVNIL 593 PF SEEARTDRP QQLRSLNGEW+++ +L Sbjct: 53 PFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 87 >SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 59 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEW 569 PF SEEARTDRP QQLRSLNGEW Sbjct: 54 PFASWRNSEEARTDRPSQQLRSLNGEW 80 >SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 46 Score = 48.4 bits (110), Expect = 5e-06 Identities = 21/30 (70%), Positives = 24/30 (80%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEWQIV 578 PF SEEARTDRP QQLRSLNGEW+++ Sbjct: 41 PFASWRNSEEARTDRPSQQLRSLNGEWRLM 70 >SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 47 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 77 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEW 569 PF SEEARTDRP QQLRSLNGEW Sbjct: 72 PFASWRNSEEARTDRPSQQLRSLNGEW 98 >SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) Length = 472 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 381 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 411 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEW 569 PF SEEARTDRP QQLRSLNGEW Sbjct: 406 PFASWRNSEEARTDRPSQQLRSLNGEW 432 >SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 59 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEW 569 PF SEEARTDRP QQLRSLNGEW Sbjct: 54 PFASWRNSEEARTDRPSQQLRSLNGEW 80 >SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 59 Score = 48.4 bits (110), Expect = 5e-06 Identities = 21/30 (70%), Positives = 24/30 (80%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEWQIV 578 PF SEEARTDRP QQLRSLNGEW+++ Sbjct: 54 PFASWRNSEEARTDRPSQQLRSLNGEWRLM 83 >SB_57634| Best HMM Match : EGF_2 (HMM E-Value=0.0014) Length = 198 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 107 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 137 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEW 569 PF SEEARTDRP QQLRSLNGEW Sbjct: 132 PFASWRNSEEARTDRPSQQLRSLNGEW 158 >SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 59 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEW 569 PF SEEARTDRP QQLRSLNGEW Sbjct: 54 PFASWRNSEEARTDRPSQQLRSLNGEW 80 >SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 83 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 113 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEW 569 PF SEEARTDRP QQLRSLNGEW Sbjct: 108 PFASWRNSEEARTDRPSQQLRSLNGEW 134 >SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 39 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 69 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEW 569 PF SEEARTDRP QQLRSLNGEW Sbjct: 64 PFASWRNSEEARTDRPSQQLRSLNGEW 90 >SB_57287| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 8 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 38 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEW 569 PF SEEARTDRP QQLRSLNGEW Sbjct: 33 PFASWRNSEEARTDRPSQQLRSLNGEW 59 >SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 18 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 48 Score = 48.4 bits (110), Expect = 5e-06 Identities = 21/30 (70%), Positives = 24/30 (80%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEWQIV 578 PF SEEARTDRP QQLRSLNGEW+++ Sbjct: 43 PFASWRNSEEARTDRPSQQLRSLNGEWRLM 72 >SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) Length = 129 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 38 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 68 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEW 569 PF SEEARTDRP QQLRSLNGEW Sbjct: 63 PFASWRNSEEARTDRPSQQLRSLNGEW 89 >SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 59 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEW 569 PF SEEARTDRP QQLRSLNGEW Sbjct: 54 PFASWRNSEEARTDRPSQQLRSLNGEW 80 >SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 103 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 133 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEW 569 PF SEEARTDRP QQLRSLNGEW Sbjct: 128 PFASWRNSEEARTDRPSQQLRSLNGEW 154 >SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 45 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 75 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEW 569 PF SEEARTDRP QQLRSLNGEW Sbjct: 70 PFASWRNSEEARTDRPSQQLRSLNGEW 96 >SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 431 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 370 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEW 569 PF SEEARTDRP QQLRSLNGEW Sbjct: 365 PFASWRNSEEARTDRPSQQLRSLNGEW 391 >SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 80 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 110 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEW 569 PF SEEARTDRP QQLRSLNGEW Sbjct: 105 PFASWRNSEEARTDRPSQQLRSLNGEW 131 >SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 50 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 80 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEW 569 PF SEEARTDRP QQLRSLNGEW Sbjct: 75 PFASWRNSEEARTDRPSQQLRSLNGEW 101 >SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 59 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEW 569 PF SEEARTDRP QQLRSLNGEW Sbjct: 54 PFASWRNSEEARTDRPSQQLRSLNGEW 80 >SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 46 Score = 48.4 bits (110), Expect = 5e-06 Identities = 21/30 (70%), Positives = 24/30 (80%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEWQIV 578 PF SEEARTDRP QQLRSLNGEW+++ Sbjct: 41 PFASWRNSEEARTDRPSQQLRSLNGEWRLM 70 >SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 59 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 89 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEW 569 PF SEEARTDRP QQLRSLNGEW Sbjct: 84 PFASWRNSEEARTDRPSQQLRSLNGEW 110 >SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 43 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 73 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEW 569 PF SEEARTDRP QQLRSLNGEW Sbjct: 68 PFASWRNSEEARTDRPSQQLRSLNGEW 94 >SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 225 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 134 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 164 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEW 569 PF SEEARTDRP QQLRSLNGEW Sbjct: 159 PFASWRNSEEARTDRPSQQLRSLNGEW 185 >SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 59 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEW 569 PF SEEARTDRP QQLRSLNGEW Sbjct: 54 PFASWRNSEEARTDRPSQQLRSLNGEW 80 >SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 63 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 93 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEW 569 PF SEEARTDRP QQLRSLNGEW Sbjct: 88 PFASWRNSEEARTDRPSQQLRSLNGEW 114 >SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 39 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 69 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEW 569 PF SEEARTDRP QQLRSLNGEW Sbjct: 64 PFASWRNSEEARTDRPSQQLRSLNGEW 90 >SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) Length = 295 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 143 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 173 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEW 569 PF SEEARTDRP QQLRSLNGEW Sbjct: 168 PFASWRNSEEARTDRPSQQLRSLNGEW 194 >SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 46 Score = 48.4 bits (110), Expect = 5e-06 Identities = 21/30 (70%), Positives = 24/30 (80%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEWQIV 578 PF SEEARTDRP QQLRSLNGEW+++ Sbjct: 41 PFASWRNSEEARTDRPSQQLRSLNGEWRLM 70 >SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 60 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 90 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEW 569 PF SEEARTDRP QQLRSLNGEW Sbjct: 85 PFASWRNSEEARTDRPSQQLRSLNGEW 111 >SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 34 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 64 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEW 569 PF SEEARTDRP QQLRSLNGEW Sbjct: 59 PFASWRNSEEARTDRPSQQLRSLNGEW 85 >SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 73 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 103 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEW 569 PF SEEARTDRP QQLRSLNGEW Sbjct: 98 PFASWRNSEEARTDRPSQQLRSLNGEW 124 >SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 56 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 86 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEW 569 PF SEEARTDRP QQLRSLNGEW Sbjct: 81 PFASWRNSEEARTDRPSQQLRSLNGEW 107 >SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 69 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 99 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEW 569 PF SEEARTDRP QQLRSLNGEW Sbjct: 94 PFASWRNSEEARTDRPSQQLRSLNGEW 120 >SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 59 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEW 569 PF SEEARTDRP QQLRSLNGEW Sbjct: 54 PFASWRNSEEARTDRPSQQLRSLNGEW 80 >SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 539 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 256 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 286 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEW 569 PF SEEARTDRP QQLRSLNGEW Sbjct: 281 PFASWRNSEEARTDRPSQQLRSLNGEW 307 >SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 59 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEW 569 PF SEEARTDRP QQLRSLNGEW Sbjct: 54 PFASWRNSEEARTDRPSQQLRSLNGEW 80 >SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) Length = 195 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 114 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 144 Score = 48.8 bits (111), Expect = 4e-06 Identities = 22/35 (62%), Positives = 26/35 (74%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEWQIVSVNIL 593 PF SEEARTDRP QQLRSLNGEW+++ +L Sbjct: 139 PFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 173 >SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 50 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 80 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEW 569 PF SEEARTDRP QQLRSLNGEW Sbjct: 75 PFASWRNSEEARTDRPSQQLRSLNGEW 101 >SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 36 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 66 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEW 569 PF SEEARTDRP QQLRSLNGEW Sbjct: 61 PFASWRNSEEARTDRPSQQLRSLNGEW 87 >SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 37 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 67 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEW 569 PF SEEARTDRP QQLRSLNGEW Sbjct: 62 PFASWRNSEEARTDRPSQQLRSLNGEW 88 >SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) Length = 192 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 101 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 131 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEW 569 PF SEEARTDRP QQLRSLNGEW Sbjct: 126 PFASWRNSEEARTDRPSQQLRSLNGEW 152 >SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 205 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 114 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 144 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEW 569 PF SEEARTDRP QQLRSLNGEW Sbjct: 139 PFASWRNSEEARTDRPSQQLRSLNGEW 165 >SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 39 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 69 Score = 48.8 bits (111), Expect = 4e-06 Identities = 22/35 (62%), Positives = 26/35 (74%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEWQIVSVNIL 593 PF SEEARTDRP QQLRSLNGEW+++ +L Sbjct: 64 PFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 98 >SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 20 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 50 Score = 48.4 bits (110), Expect = 5e-06 Identities = 21/30 (70%), Positives = 24/30 (80%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEWQIV 578 PF SEEARTDRP QQLRSLNGEW+++ Sbjct: 45 PFASWRNSEEARTDRPSQQLRSLNGEWRLM 74 >SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 58 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 88 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEW 569 PF SEEARTDRP QQLRSLNGEW Sbjct: 83 PFASWRNSEEARTDRPSQQLRSLNGEW 109 >SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 37 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 67 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEW 569 PF SEEARTDRP QQLRSLNGEW Sbjct: 62 PFASWRNSEEARTDRPSQQLRSLNGEW 88 >SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 34 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 64 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEW 569 PF SEEARTDRP QQLRSLNGEW Sbjct: 59 PFASWRNSEEARTDRPSQQLRSLNGEW 85 >SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) Length = 349 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 11 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 41 Score = 48.8 bits (111), Expect = 4e-06 Identities = 22/35 (62%), Positives = 26/35 (74%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEWQIVSVNIL 593 PF SEEARTDRP QQLRSLNGEW+++ +L Sbjct: 36 PFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 70 >SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 19 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 49 Score = 48.4 bits (110), Expect = 5e-06 Identities = 21/30 (70%), Positives = 24/30 (80%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEWQIV 578 PF SEEARTDRP QQLRSLNGEW+++ Sbjct: 44 PFASWRNSEEARTDRPSQQLRSLNGEWRLM 73 >SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 487 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 396 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 426 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEW 569 PF SEEARTDRP QQLRSLNGEW Sbjct: 421 PFASWRNSEEARTDRPSQQLRSLNGEW 447 >SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 45 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 75 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEW 569 PF SEEARTDRP QQLRSLNGEW Sbjct: 70 PFASWRNSEEARTDRPSQQLRSLNGEW 96 >SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 54 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 84 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEW 569 PF SEEARTDRP QQLRSLNGEW Sbjct: 79 PFASWRNSEEARTDRPSQQLRSLNGEW 105 >SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 36 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 66 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEW 569 PF SEEARTDRP QQLRSLNGEW Sbjct: 61 PFASWRNSEEARTDRPSQQLRSLNGEW 87 >SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 59 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEW 569 PF SEEARTDRP QQLRSLNGEW Sbjct: 54 PFASWRNSEEARTDRPSQQLRSLNGEW 80 >SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 269 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 119 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 149 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEW 569 PF SEEARTDRP QQLRSLNGEW Sbjct: 144 PFASWRNSEEARTDRPSQQLRSLNGEW 170 >SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 55 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 85 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEW 569 PF SEEARTDRP QQLRSLNGEW Sbjct: 80 PFASWRNSEEARTDRPSQQLRSLNGEW 106 >SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 65 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 95 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEW 569 PF SEEARTDRP QQLRSLNGEW Sbjct: 90 PFASWRNSEEARTDRPSQQLRSLNGEW 116 >SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 68 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 98 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEW 569 PF SEEARTDRP QQLRSLNGEW Sbjct: 93 PFASWRNSEEARTDRPSQQLRSLNGEW 119 >SB_54473| Best HMM Match : DLIC (HMM E-Value=0) Length = 1401 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 414 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 444 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEW 569 PF SEEARTDRP QQLRSLNGEW Sbjct: 439 PFASWRNSEEARTDRPSQQLRSLNGEW 465 >SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 59 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEW 569 PF SEEARTDRP QQLRSLNGEW Sbjct: 54 PFASWRNSEEARTDRPSQQLRSLNGEW 80 >SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1) Length = 174 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 111 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 141 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEW 569 PF SEEARTDRP QQLRSLNGEW Sbjct: 136 PFASWRNSEEARTDRPSQQLRSLNGEW 162 >SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3) Length = 157 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 67 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 97 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEW 569 PF SEEARTDRP QQLRSLNGEW Sbjct: 92 PFASWRNSEEARTDRPSQQLRSLNGEW 118 >SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 56 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 86 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEW 569 PF SEEARTDRP QQLRSLNGEW Sbjct: 81 PFASWRNSEEARTDRPSQQLRSLNGEW 107 >SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) Length = 137 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 46 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 76 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEW 569 PF SEEARTDRP QQLRSLNGEW Sbjct: 71 PFASWRNSEEARTDRPSQQLRSLNGEW 97 >SB_53980| Best HMM Match : UCR_TM (HMM E-Value=9.9) Length = 140 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 49 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 79 Score = 44.0 bits (99), Expect = 1e-04 Identities = 19/27 (70%), Positives = 21/27 (77%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEW 569 PF +E+ARTDRP QQLRSLNGEW Sbjct: 74 PFASWRNNEKARTDRPSQQLRSLNGEW 100 >SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 252 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 161 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 191 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEW 569 PF SEEARTDRP QQLRSLNGEW Sbjct: 186 PFASWRNSEEARTDRPSQQLRSLNGEW 212 >SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 59 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEW 569 PF SEEARTDRP QQLRSLNGEW Sbjct: 54 PFASWRNSEEARTDRPSQQLRSLNGEW 80 >SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 65 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 95 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEW 569 PF SEEARTDRP QQLRSLNGEW Sbjct: 90 PFASWRNSEEARTDRPSQQLRSLNGEW 116 >SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 52 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 82 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEW 569 PF SEEARTDRP QQLRSLNGEW Sbjct: 77 PFASWRNSEEARTDRPSQQLRSLNGEW 103 >SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 37 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 67 Score = 48.4 bits (110), Expect = 5e-06 Identities = 21/30 (70%), Positives = 24/30 (80%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEWQIV 578 PF SEEARTDRP QQLRSLNGEW+++ Sbjct: 62 PFASWRNSEEARTDRPSQQLRSLNGEWRLM 91 >SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 63 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 93 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEW 569 PF SEEARTDRP QQLRSLNGEW Sbjct: 88 PFASWRNSEEARTDRPSQQLRSLNGEW 114 >SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 59 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEW 569 PF SEEARTDRP QQLRSLNGEW Sbjct: 54 PFASWRNSEEARTDRPSQQLRSLNGEW 80 >SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 59 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEW 569 PF SEEARTDRP QQLRSLNGEW Sbjct: 54 PFASWRNSEEARTDRPSQQLRSLNGEW 80 >SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 42 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 72 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEW 569 PF SEEARTDRP QQLRSLNGEW Sbjct: 67 PFASWRNSEEARTDRPSQQLRSLNGEW 93 >SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 59 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEW 569 PF SEEARTDRP QQLRSLNGEW Sbjct: 54 PFASWRNSEEARTDRPSQQLRSLNGEW 80 >SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 300 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 185 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 215 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEW 569 PF SEEARTDRP QQLRSLNGEW Sbjct: 210 PFASWRNSEEARTDRPSQQLRSLNGEW 236 >SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 34 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 64 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEW 569 PF SEEARTDRP QQLRSLNGEW Sbjct: 59 PFASWRNSEEARTDRPSQQLRSLNGEW 85 >SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 40 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 70 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEW 569 PF SEEARTDRP QQLRSLNGEW Sbjct: 65 PFASWRNSEEARTDRPSQQLRSLNGEW 91 >SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 54 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 84 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEW 569 PF SEEARTDRP QQLRSLNGEW Sbjct: 79 PFASWRNSEEARTDRPSQQLRSLNGEW 105 >SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) Length = 142 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 51 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 81 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEW 569 PF SEEARTDRP QQLRSLNGEW Sbjct: 76 PFASWRNSEEARTDRPSQQLRSLNGEW 102 >SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 59 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEW 569 PF SEEARTDRP QQLRSLNGEW Sbjct: 54 PFASWRNSEEARTDRPSQQLRSLNGEW 80 >SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 34 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 64 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEW 569 PF SEEARTDRP QQLRSLNGEW Sbjct: 59 PFASWRNSEEARTDRPSQQLRSLNGEW 85 >SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 35 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 65 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEW 569 PF SEEARTDRP QQLRSLNGEW Sbjct: 60 PFASWRNSEEARTDRPSQQLRSLNGEW 86 >SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 49 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 79 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEW 569 PF SEEARTDRP QQLRSLNGEW Sbjct: 74 PFASWRNSEEARTDRPSQQLRSLNGEW 100 >SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 39 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 69 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEW 569 PF SEEARTDRP QQLRSLNGEW Sbjct: 64 PFASWRNSEEARTDRPSQQLRSLNGEW 90 >SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 132 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 162 Score = 48.4 bits (110), Expect = 5e-06 Identities = 21/30 (70%), Positives = 24/30 (80%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEWQIV 578 PF SEEARTDRP QQLRSLNGEW+++ Sbjct: 157 PFASWRNSEEARTDRPSQQLRSLNGEWRLM 186 >SB_52260| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 59 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEW 569 PF SEEARTDRP QQLRSLNGEW Sbjct: 54 PFASWRNSEEARTDRPSQQLRSLNGEW 80 >SB_52253| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 41 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 71 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEW 569 PF SEEARTDRP QQLRSLNGEW Sbjct: 66 PFASWRNSEEARTDRPSQQLRSLNGEW 92 >SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 84 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 114 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEW 569 PF SEEARTDRP QQLRSLNGEW Sbjct: 109 PFASWRNSEEARTDRPSQQLRSLNGEW 135 >SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 22 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 52 Score = 48.8 bits (111), Expect = 4e-06 Identities = 22/35 (62%), Positives = 26/35 (74%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEWQIVSVNIL 593 PF SEEARTDRP QQLRSLNGEW+++ +L Sbjct: 47 PFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 81 >SB_52086| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 59 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEW 569 PF SEEARTDRP QQLRSLNGEW Sbjct: 54 PFASWRNSEEARTDRPSQQLRSLNGEW 80 >SB_51989| Best HMM Match : Extensin_2 (HMM E-Value=0.29) Length = 473 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 370 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEW 569 PF SEEARTDRP QQLRSLNGEW Sbjct: 365 PFASWRNSEEARTDRPSQQLRSLNGEW 391 >SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 57 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 87 Score = 48.8 bits (111), Expect = 4e-06 Identities = 22/35 (62%), Positives = 26/35 (74%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEWQIVSVNIL 593 PF SEEARTDRP QQLRSLNGEW+++ +L Sbjct: 82 PFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 116 >SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 21 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 51 Score = 48.4 bits (110), Expect = 5e-06 Identities = 21/30 (70%), Positives = 24/30 (80%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEWQIV 578 PF SEEARTDRP QQLRSLNGEW+++ Sbjct: 46 PFASWRNSEEARTDRPSQQLRSLNGEWRLM 75 >SB_51427| Best HMM Match : DUF855 (HMM E-Value=4) Length = 301 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 109 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 139 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEW 569 PF SEEARTDRP QQLRSLNGEW Sbjct: 134 PFASWRNSEEARTDRPSQQLRSLNGEW 160 >SB_51409| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 59 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEW 569 PF SEEARTDRP QQLRSLNGEW Sbjct: 54 PFASWRNSEEARTDRPSQQLRSLNGEW 80 >SB_51320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 59 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEW 569 PF SEEARTDRP QQLRSLNGEW Sbjct: 54 PFASWRNSEEARTDRPSQQLRSLNGEW 80 >SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 86 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 116 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEW 569 PF SEEARTDRP QQLRSLNGEW Sbjct: 111 PFASWRNSEEARTDRPSQQLRSLNGEW 137 >SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 36 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 66 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEW 569 PF SEEARTDRP QQLRSLNGEW Sbjct: 61 PFASWRNSEEARTDRPSQQLRSLNGEW 87 >SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 60 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 90 Score = 48.8 bits (111), Expect = 4e-06 Identities = 22/35 (62%), Positives = 26/35 (74%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEWQIVSVNIL 593 PF SEEARTDRP QQLRSLNGEW+++ +L Sbjct: 85 PFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 119 >SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) Length = 385 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 294 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 324 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEW 569 PF SEEARTDRP QQLRSLNGEW Sbjct: 319 PFASWRNSEEARTDRPSQQLRSLNGEW 345 >SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 57 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 87 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEW 569 PF SEEARTDRP QQLRSLNGEW Sbjct: 82 PFASWRNSEEARTDRPSQQLRSLNGEW 108 >SB_50493| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 58 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 88 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEW 569 PF SEEARTDRP QQLRSLNGEW Sbjct: 83 PFASWRNSEEARTDRPSQQLRSLNGEW 109 >SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 46 Score = 48.4 bits (110), Expect = 5e-06 Identities = 21/30 (70%), Positives = 24/30 (80%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEWQIV 578 PF SEEARTDRP QQLRSLNGEW+++ Sbjct: 41 PFASWRNSEEARTDRPSQQLRSLNGEWRLM 70 >SB_50417| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 36 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 66 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEW 569 PF SEEARTDRP QQLRSLNGEW Sbjct: 61 PFASWRNSEEARTDRPSQQLRSLNGEW 87 >SB_50270| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 857 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 411 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 441 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEW 569 PF SEEARTDRP QQLRSLNGEW Sbjct: 436 PFASWRNSEEARTDRPSQQLRSLNGEW 462 >SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 95 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 125 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEW 569 PF SEEARTDRP QQLRSLNGEW Sbjct: 120 PFASWRNSEEARTDRPSQQLRSLNGEW 146 >SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 51 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 81 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEW 569 PF SEEARTDRP QQLRSLNGEW Sbjct: 76 PFASWRNSEEARTDRPSQQLRSLNGEW 102 >SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 43 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 73 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEW 569 PF SEEARTDRP QQLRSLNGEW Sbjct: 68 PFASWRNSEEARTDRPSQQLRSLNGEW 94 >SB_49896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 184 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 93 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 123 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEW 569 PF SEEARTDRP QQLRSLNGEW Sbjct: 118 PFASWRNSEEARTDRPSQQLRSLNGEW 144 >SB_49839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 43 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 73 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEW 569 PF SEEARTDRP QQLRSLNGEW Sbjct: 68 PFASWRNSEEARTDRPSQQLRSLNGEW 94 >SB_49814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 302 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 211 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 241 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEW 569 PF SEEARTDRP QQLRSLNGEW Sbjct: 236 PFASWRNSEEARTDRPSQQLRSLNGEW 262 >SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 43 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 73 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEW 569 PF SEEARTDRP QQLRSLNGEW Sbjct: 68 PFASWRNSEEARTDRPSQQLRSLNGEW 94 >SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1615 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 213 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 243 Score = 48.8 bits (111), Expect = 4e-06 Identities = 22/35 (62%), Positives = 26/35 (74%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEWQIVSVNIL 593 PF SEEARTDRP QQLRSLNGEW+++ +L Sbjct: 238 PFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 272 >SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 88 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 33 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 63 Score = 48.4 bits (110), Expect = 5e-06 Identities = 21/30 (70%), Positives = 24/30 (80%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEWQIV 578 PF SEEARTDRP QQLRSLNGEW+++ Sbjct: 58 PFASWRNSEEARTDRPSQQLRSLNGEWRLM 87 >SB_49530| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 59 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEW 569 PF SEEARTDRP QQLRSLNGEW Sbjct: 54 PFASWRNSEEARTDRPSQQLRSLNGEW 80 >SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 48 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 78 Score = 48.8 bits (111), Expect = 4e-06 Identities = 22/35 (62%), Positives = 26/35 (74%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEWQIVSVNIL 593 PF SEEARTDRP QQLRSLNGEW+++ +L Sbjct: 73 PFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 107 >SB_49465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 38 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 68 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEW 569 PF SEEARTDRP QQLRSLNGEW Sbjct: 63 PFASWRNSEEARTDRPSQQLRSLNGEW 89 >SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 43 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 73 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEW 569 PF SEEARTDRP QQLRSLNGEW Sbjct: 68 PFASWRNSEEARTDRPSQQLRSLNGEW 94 >SB_49395| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 238 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 147 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 177 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEW 569 PF SEEARTDRP QQLRSLNGEW Sbjct: 172 PFASWRNSEEARTDRPSQQLRSLNGEW 198 >SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 45 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 75 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEW 569 PF SEEARTDRP QQLRSLNGEW Sbjct: 70 PFASWRNSEEARTDRPSQQLRSLNGEW 96 >SB_49211| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 35 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 65 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEW 569 PF SEEARTDRP QQLRSLNGEW Sbjct: 60 PFASWRNSEEARTDRPSQQLRSLNGEW 86 >SB_49150| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 55 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 85 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEW 569 PF SEEARTDRP QQLRSLNGEW Sbjct: 80 PFASWRNSEEARTDRPSQQLRSLNGEW 106 >SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 40 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 70 Score = 48.8 bits (111), Expect = 4e-06 Identities = 22/35 (62%), Positives = 26/35 (74%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEWQIVSVNIL 593 PF SEEARTDRP QQLRSLNGEW+++ +L Sbjct: 65 PFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 99 >SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 75 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 105 Score = 48.8 bits (111), Expect = 4e-06 Identities = 22/35 (62%), Positives = 26/35 (74%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEWQIVSVNIL 593 PF SEEARTDRP QQLRSLNGEW+++ +L Sbjct: 100 PFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 134 >SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) Length = 286 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 195 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 225 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEW 569 PF SEEARTDRP QQLRSLNGEW Sbjct: 220 PFASWRNSEEARTDRPSQQLRSLNGEW 246 >SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 53 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 83 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEW 569 PF SEEARTDRP QQLRSLNGEW Sbjct: 78 PFASWRNSEEARTDRPSQQLRSLNGEW 104 >SB_48522| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 32 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 62 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEW 569 PF SEEARTDRP QQLRSLNGEW Sbjct: 57 PFASWRNSEEARTDRPSQQLRSLNGEW 83 >SB_48514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 237 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 86 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 116 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEW 569 PF SEEARTDRP QQLRSLNGEW Sbjct: 111 PFASWRNSEEARTDRPSQQLRSLNGEW 137 >SB_48486| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 59 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEW 569 PF SEEARTDRP QQLRSLNGEW Sbjct: 54 PFASWRNSEEARTDRPSQQLRSLNGEW 80 >SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 22 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 52 Score = 48.8 bits (111), Expect = 4e-06 Identities = 22/35 (62%), Positives = 26/35 (74%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEWQIVSVNIL 593 PF SEEARTDRP QQLRSLNGEW+++ +L Sbjct: 47 PFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 81 >SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 49 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 79 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEW 569 PF SEEARTDRP QQLRSLNGEW Sbjct: 74 PFASWRNSEEARTDRPSQQLRSLNGEW 100 >SB_48129| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 59 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEW 569 PF SEEARTDRP QQLRSLNGEW Sbjct: 54 PFASWRNSEEARTDRPSQQLRSLNGEW 80 >SB_48100| Best HMM Match : Transformer (HMM E-Value=5.4) Length = 325 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 187 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 217 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEW 569 PF SEEARTDRP QQLRSLNGEW Sbjct: 212 PFASWRNSEEARTDRPSQQLRSLNGEW 238 >SB_48063| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 59 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEW 569 PF SEEARTDRP QQLRSLNGEW Sbjct: 54 PFASWRNSEEARTDRPSQQLRSLNGEW 80 >SB_48045| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 57 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 87 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEW 569 PF SEEARTDRP QQLRSLNGEW Sbjct: 82 PFASWRNSEEARTDRPSQQLRSLNGEW 108 >SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 67 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 97 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEW 569 PF SEEARTDRP QQLRSLNGEW Sbjct: 92 PFASWRNSEEARTDRPSQQLRSLNGEW 118 >SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 50 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 80 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEW 569 PF SEEARTDRP QQLRSLNGEW Sbjct: 75 PFASWRNSEEARTDRPSQQLRSLNGEW 101 >SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 57 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 87 Score = 48.8 bits (111), Expect = 4e-06 Identities = 22/35 (62%), Positives = 26/35 (74%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEWQIVSVNIL 593 PF SEEARTDRP QQLRSLNGEW+++ +L Sbjct: 82 PFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 116 >SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016) Length = 318 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 100 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 130 Score = 48.8 bits (111), Expect = 4e-06 Identities = 22/37 (59%), Positives = 26/37 (70%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEWQIVSVNILLK 599 PF SEEARTDRP QQLRSLNGEW+++ + K Sbjct: 125 PFASWRNSEEARTDRPSQQLRSLNGEWRLMRRQVRAK 161 >SB_47536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 59 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEW 569 PF SEEARTDRP QQLRSLNGEW Sbjct: 54 PFASWRNSEEARTDRPSQQLRSLNGEW 80 >SB_47480| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 167 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 76 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 106 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEW 569 PF SEEARTDRP QQLRSLNGEW Sbjct: 101 PFASWRNSEEARTDRPSQQLRSLNGEW 127 >SB_47399| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 59 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEW 569 PF SEEARTDRP QQLRSLNGEW Sbjct: 54 PFASWRNSEEARTDRPSQQLRSLNGEW 80 >SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 96 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 126 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEW 569 PF SEEARTDRP QQLRSLNGEW Sbjct: 121 PFASWRNSEEARTDRPSQQLRSLNGEW 147 >SB_47276| Best HMM Match : DUF851 (HMM E-Value=9.6) Length = 154 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 73 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 103 Score = 48.8 bits (111), Expect = 4e-06 Identities = 22/35 (62%), Positives = 26/35 (74%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEWQIVSVNIL 593 PF SEEARTDRP QQLRSLNGEW+++ +L Sbjct: 98 PFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 132 >SB_47213| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 103 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 40 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 70 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEW 569 PF SEEARTDRP QQLRSLNGEW Sbjct: 65 PFASWRNSEEARTDRPSQQLRSLNGEW 91 >SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 49 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 79 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEW 569 PF SEEARTDRP QQLRSLNGEW Sbjct: 74 PFASWRNSEEARTDRPSQQLRSLNGEW 100 >SB_46889| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 754 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 663 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 693 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEW 569 PF SEEARTDRP QQLRSLNGEW Sbjct: 688 PFASWRNSEEARTDRPSQQLRSLNGEW 714 >SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) Length = 139 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 48 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 78 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEW 569 PF SEEARTDRP QQLRSLNGEW Sbjct: 73 PFASWRNSEEARTDRPSQQLRSLNGEW 99 >SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 37 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 67 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEW 569 PF SEEARTDRP QQLRSLNGEW Sbjct: 62 PFASWRNSEEARTDRPSQQLRSLNGEW 88 >SB_46649| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 28 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 58 Score = 48.8 bits (111), Expect = 4e-06 Identities = 22/35 (62%), Positives = 26/35 (74%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEWQIVSVNIL 593 PF SEEARTDRP QQLRSLNGEW+++ +L Sbjct: 53 PFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 87 >SB_46589| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 562 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 176 Score = 48.4 bits (110), Expect = 5e-06 Identities = 21/30 (70%), Positives = 24/30 (80%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEWQIV 578 PF SEEARTDRP QQLRSLNGEW+++ Sbjct: 171 PFASWRNSEEARTDRPSQQLRSLNGEWRLM 200 >SB_46529| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 38 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 68 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEW 569 PF SEEARTDRP QQLRSLNGEW Sbjct: 63 PFASWRNSEEARTDRPSQQLRSLNGEW 89 >SB_46517| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 59 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEW 569 PF SEEARTDRP QQLRSLNGEW Sbjct: 54 PFASWRNSEEARTDRPSQQLRSLNGEW 80 >SB_46424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 59 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEW 569 PF SEEARTDRP QQLRSLNGEW Sbjct: 54 PFASWRNSEEARTDRPSQQLRSLNGEW 80 >SB_46412| Best HMM Match : HEAT (HMM E-Value=8) Length = 140 Score = 72.1 bits (169), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 415 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 59 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 89 Score = 48.8 bits (111), Expect = 4e-06 Identities = 22/35 (62%), Positives = 26/35 (74%) Frame = +3 Query: 489 PFRQLAYSEEARTDRPFQQLRSLNGEWQIVSVNIL 593 PF SEEARTDRP QQLRSLNGEW+++ +L Sbjct: 84 PFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 118 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,818,891 Number of Sequences: 59808 Number of extensions: 552531 Number of successful extensions: 9948 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 5693 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9878 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1781448916 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -