BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0263 (688 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY242387-1|AAO72539.2| 693|Apis mellifera prophenoloxidase prot... 25 0.89 AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. 22 6.3 DQ201783-1|ABB05503.1| 381|Apis mellifera capa receptor-like GP... 21 8.3 >AY242387-1|AAO72539.2| 693|Apis mellifera prophenoloxidase protein. Length = 693 Score = 24.6 bits (51), Expect = 0.89 Identities = 12/39 (30%), Positives = 20/39 (51%) Frame = -3 Query: 167 RPRAARQGMASFKSG*SGTMARRVIFALNFTPRNESGTV 51 +PRA + +A F +G V F+ PR+ SG++ Sbjct: 648 QPRAGVETLAQFLTGNMAVTEVTVRFSDTIVPRSRSGSI 686 >AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. Length = 996 Score = 21.8 bits (44), Expect = 6.3 Identities = 9/25 (36%), Positives = 14/25 (56%) Frame = -1 Query: 442 SHDVVKRRPVNCNTTHYRANWVPGP 368 S + K++P +C+T YR V P Sbjct: 560 SDECNKKQPSDCDTLEYRNGEVTTP 584 >DQ201783-1|ABB05503.1| 381|Apis mellifera capa receptor-like GPCR protein. Length = 381 Score = 21.4 bits (43), Expect = 8.3 Identities = 8/16 (50%), Positives = 9/16 (56%) Frame = +3 Query: 201 CRNAPSSAERRSFFLC 248 C N+ S ER S F C Sbjct: 363 CNNSSSDKERNSSFKC 378 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 207,645 Number of Sequences: 438 Number of extensions: 4614 Number of successful extensions: 9 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20952180 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -