BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0262 (672 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF487781-1|AAL96668.1| 533|Anopheles gambiae cytochrome P450 CY... 25 2.2 X87411-1|CAA60858.1| 599|Anopheles gambiae maltase-like protein... 23 6.6 >AF487781-1|AAL96668.1| 533|Anopheles gambiae cytochrome P450 CYP9L1 protein protein. Length = 533 Score = 25.0 bits (52), Expect = 2.2 Identities = 12/38 (31%), Positives = 19/38 (50%) Frame = -3 Query: 232 RFPSPNKQNKQAMQTPFLNFRKFNAIKKVSIKLYD*FL 119 RFP+ M TP R IK++++K +D F+ Sbjct: 66 RFPNAKMYGMFEMFTPMFVIRDPELIKQITVKDFDHFI 103 >X87411-1|CAA60858.1| 599|Anopheles gambiae maltase-like protein Agm2 protein. Length = 599 Score = 23.4 bits (48), Expect = 6.6 Identities = 16/60 (26%), Positives = 23/60 (38%), Gaps = 2/60 (3%) Frame = +1 Query: 490 FYWP--CHAWFTKYCYALGLGINKAFTEVQIKTIQHLEHMEHFKIRNSLLSLRVEPVTNW 663 F W +A FT L + + V +KT Q H K+ L++LR W Sbjct: 427 FQWDSTANAGFTNASVKPWLPLATDYPLVNVKTQQESAQNSHIKVFKELMNLRGTNTLIW 486 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 696,889 Number of Sequences: 2352 Number of extensions: 13865 Number of successful extensions: 62 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 62 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 62 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 67322955 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -