BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0261 (696 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_18656| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_2543| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_38717| Best HMM Match : Cornifin (HMM E-Value=7.2) 28 8.3 SB_29832| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.3 >SB_18656| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3292 Score = 28.3 bits (60), Expect = 6.3 Identities = 23/73 (31%), Positives = 31/73 (42%), Gaps = 2/73 (2%) Frame = -3 Query: 679 ARHRK*SSSILPGTTAIIPSAFPEIFFATDHPGYGMSSPPRCFPSAMTCPSSN--EACGS 506 AR+R+ SI+P T I P+ E+ T GM PP P + S E Sbjct: 2258 ARYRRNVESIIPPYTVITPNILMELHPVTIRNFNGMQFPPS--PDSFESYSWQWAEVTNK 2315 Query: 505 IKR*AAAWLCPWH 467 +K A +L P H Sbjct: 2316 VKLPRALFLSPGH 2328 >SB_2543| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 215 Score = 28.3 bits (60), Expect = 6.3 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = -3 Query: 121 KNVGYVLFLKH*GLQQALPILNKKIKAG*VFKCTL 17 + V ++LF+ Q A+ +NKK G KCT+ Sbjct: 51 RGVAFILFIDRQSAQNAVAAVNKKQMFGRTIKCTI 85 >SB_38717| Best HMM Match : Cornifin (HMM E-Value=7.2) Length = 318 Score = 27.9 bits (59), Expect = 8.3 Identities = 15/30 (50%), Positives = 16/30 (53%) Frame = -2 Query: 491 SGLALPLALLKSMGDGNHSPSGGPYARLPT 402 SG+ PLA S D H P GGP A PT Sbjct: 33 SGIFSPLASSTSASDSRHRPVGGP-AYSPT 61 >SB_29832| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1293 Score = 27.9 bits (59), Expect = 8.3 Identities = 12/36 (33%), Positives = 18/36 (50%) Frame = -1 Query: 684 APPATGSRVHPYYLEPLRSSPVRFQRSFLPRTIRAM 577 APP G + + YYL ++ VR+ R T R + Sbjct: 1235 APPKAGPKTYCYYLSTVQQLLVRYPRETTETTTRVL 1270 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,101,947 Number of Sequences: 59808 Number of extensions: 515196 Number of successful extensions: 1117 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1013 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1116 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1817559367 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -