BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0260 (683 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC823.16c |mug179||WD repeat protein Mug179|Schizosaccharomyce... 26 4.4 SPMIT.05 |cob1|cob|cytochrome b, Cob1|Schizosaccharomyces pombe|... 25 7.7 >SPAC823.16c |mug179||WD repeat protein Mug179|Schizosaccharomyces pombe|chr 1|||Manual Length = 335 Score = 26.2 bits (55), Expect = 4.4 Identities = 14/46 (30%), Positives = 27/46 (58%) Frame = -1 Query: 431 ASFLFLMRLNFESKYVFKFLG*KRIVKLCELFYFVPLVFLQV*TYN 294 +S L + ++ ES + K + KR + LC +FY P++ ++ T+N Sbjct: 53 SSLLAFVNISPESTRLLKLVDIKRDIVLCRIFYPSPVLSVRF-TWN 97 >SPMIT.05 |cob1|cob|cytochrome b, Cob1|Schizosaccharomyces pombe|chr mitochondrial|||Manual Length = 387 Score = 25.4 bits (53), Expect = 7.7 Identities = 13/41 (31%), Positives = 23/41 (56%) Frame = -3 Query: 522 VLR*LSMCFIL*AFHK*LLSFFYSFYRCHTSKFLIPYAFKF 400 ++R ++ F+L AFH SFF+ F H + L ++K+ Sbjct: 68 IVRDVNYGFLLRAFHANGASFFFIFLYLHIGRGLYYGSYKY 108 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,541,221 Number of Sequences: 5004 Number of extensions: 46696 Number of successful extensions: 77 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 77 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 77 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 315915086 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -