BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0260 (683 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_40852| Best HMM Match : SURF6 (HMM E-Value=3.8) 28 6.1 SB_17282| Best HMM Match : LRR_1 (HMM E-Value=1.1e-07) 28 8.1 >SB_40852| Best HMM Match : SURF6 (HMM E-Value=3.8) Length = 296 Score = 28.3 bits (60), Expect = 6.1 Identities = 15/42 (35%), Positives = 24/42 (57%) Frame = +1 Query: 373 KNLNTYLLSKFKRIRNKKLARMTTIKGIKKTQKLFMKCLQNE 498 K LN + +K K R K+ + +KGI K + L +K +QN+ Sbjct: 17 KLLNNIVAAKLKNEREKERLSLK-LKGISKQEDLHLKNIQNQ 57 >SB_17282| Best HMM Match : LRR_1 (HMM E-Value=1.1e-07) Length = 651 Score = 27.9 bits (59), Expect = 8.1 Identities = 10/20 (50%), Positives = 15/20 (75%) Frame = +2 Query: 290 RYYMFKPEETLKEQNKTIHK 349 R+YM+KP E L+ +NK + K Sbjct: 240 RFYMYKPFEDLEPENKDVFK 259 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,367,137 Number of Sequences: 59808 Number of extensions: 281455 Number of successful extensions: 509 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 496 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 509 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1769412099 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -