BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0259 (698 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value X06905-1|CAA30009.1| 489|Tribolium castaneum protein ( Triboliu... 25 0.59 DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulati... 24 1.4 U04271-2|AAA03709.1| 490|Tribolium castaneum alpha-amylase II p... 23 2.4 U04271-1|AAA03708.1| 490|Tribolium castaneum alpha-amylase I pr... 23 2.4 AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory recept... 22 4.2 AJ005422-1|CAA06528.1| 287|Tribolium castaneum caudal protein p... 22 5.5 >X06905-1|CAA30009.1| 489|Tribolium castaneum protein ( Tribolium castaneum mRNAfor alhpa amylase 3'region. ). Length = 489 Score = 25.0 bits (52), Expect = 0.59 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = -1 Query: 296 GLTALHWAADRNAITH 249 GL H+AADRN+I H Sbjct: 16 GLFVPHFAADRNSIVH 31 >DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulation protein. Length = 947 Score = 23.8 bits (49), Expect = 1.4 Identities = 20/59 (33%), Positives = 23/59 (38%), Gaps = 5/59 (8%) Frame = -3 Query: 297 WPHCTTLGC*QKCNYALSAAL---SGGCPIDAVD-EC-GQTALHYAVSCGHVESTKILT 136 W C C + S+AL SGG V C G T A CG VES +T Sbjct: 886 WRECDKATCEKLFRMKKSSALRPASGGTTARVVRCVCAGSTGTRRATGCGRVESVAEVT 944 >U04271-2|AAA03709.1| 490|Tribolium castaneum alpha-amylase II protein. Length = 490 Score = 23.0 bits (47), Expect = 2.4 Identities = 8/11 (72%), Positives = 10/11 (90%) Frame = -1 Query: 281 HWAADRNAITH 249 H+AADRN+I H Sbjct: 22 HFAADRNSIVH 32 >U04271-1|AAA03708.1| 490|Tribolium castaneum alpha-amylase I protein. Length = 490 Score = 23.0 bits (47), Expect = 2.4 Identities = 8/11 (72%), Positives = 10/11 (90%) Frame = -1 Query: 281 HWAADRNAITH 249 H+AADRN+I H Sbjct: 22 HFAADRNSIVH 32 >AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory receptor candidate 46 protein. Length = 1451 Score = 22.2 bits (45), Expect = 4.2 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = +3 Query: 531 SLASSLGISLRFFQASH 581 SLA S+G+ L F A+H Sbjct: 801 SLAHSVGVFLTIFNAAH 817 >AJ005422-1|CAA06528.1| 287|Tribolium castaneum caudal protein protein. Length = 287 Score = 21.8 bits (44), Expect = 5.5 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = +2 Query: 500 DHIFQQSNIFLLSLFTGHIFKILPGLPFPTS 592 D++F N F+ T H +++ GLP PTS Sbjct: 227 DNLFH--NGFMQEQSTHHQGQLVVGLPAPTS 255 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 171,076 Number of Sequences: 336 Number of extensions: 3674 Number of successful extensions: 7 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18426585 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -