BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0259 (698 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g53470.1 68418.m06645 acyl-CoA binding protein, putative / AC... 61 8e-10 At4g27780.1 68417.m03990 acyl-CoA binding protein 2 (ACBP2) iden... 61 8e-10 At4g24230.2 68417.m03478 acyl-CoA binding protein, putative / AC... 52 4e-07 At4g24230.1 68417.m03477 acyl-CoA binding protein, putative / AC... 52 4e-07 At1g31812.1 68414.m03905 acyl-CoA binding protein / ACBP identic... 52 5e-07 At3g05420.2 68416.m00594 acyl-CoA binding family protein similar... 49 3e-06 At3g05420.1 68416.m00593 acyl-CoA binding family protein similar... 49 3e-06 At5g27630.1 68418.m03310 acyl-CoA binding family protein similar... 43 2e-04 At4g35450.4 68417.m05039 ankyrin repeat family protein / AFT pro... 41 7e-04 At4g35450.3 68417.m05038 ankyrin repeat family protein / AFT pro... 41 7e-04 At4g35450.2 68417.m05037 ankyrin repeat family protein / AFT pro... 41 7e-04 At4g35450.1 68417.m05036 ankyrin repeat family protein / AFT pro... 41 7e-04 At2g17390.1 68415.m02008 ankyrin repeat family protein contains ... 40 0.001 At2g03430.1 68415.m00301 ankyrin repeat family protein contains ... 40 0.002 At5g02620.1 68418.m00198 ankyrin repeat family protein contains ... 38 0.008 At2g25600.1 68415.m03066 potassium channel protein, putative sim... 38 0.008 At3g01750.1 68416.m00112 ankyrin repeat family protein contains ... 36 0.034 At3g04710.1 68416.m00505 ankyrin repeat family protein contains ... 35 0.045 At4g19150.1 68417.m02825 ankyrin repeat family protein contains ... 34 0.10 At3g03790.2 68416.m00389 ankyrin repeat family protein / regulat... 33 0.14 At3g03790.1 68416.m00388 ankyrin repeat family protein / regulat... 33 0.14 At2g31800.1 68415.m03882 ankyrin protein kinase, putative simila... 33 0.14 At2g47450.1 68415.m05922 chloroplast signal recognition particle... 33 0.18 At5g12320.1 68418.m01448 ankyrin repeat family protein contains ... 33 0.24 At3g12360.1 68416.m01541 ankyrin repeat family protein contains ... 33 0.24 At1g10870.1 68414.m01249 ARF GTPase-activating domain-containing... 32 0.32 At3g59830.1 68416.m06676 ankyrin protein kinase, putative simila... 32 0.42 At2g04740.1 68415.m00484 ankyrin repeat family protein contains ... 32 0.42 At5g20350.1 68418.m02421 zinc finger (DHHC type) family protein ... 31 0.56 At3g11340.1 68416.m01379 UDP-glucoronosyl/UDP-glucosyl transfera... 31 0.73 At2g31820.1 68415.m03886 ankyrin repeat family protein contains ... 31 0.73 At1g07710.1 68414.m00831 ankyrin repeat family protein contains ... 31 0.73 At4g32500.1 68417.m04626 potassium channel protein, putative sim... 30 1.3 At4g03450.1 68417.m00472 ankyrin repeat family protein contains ... 30 1.3 At2g01680.1 68415.m00095 ankyrin repeat family protein contains ... 30 1.3 At1g05640.1 68414.m00585 ankyrin repeat family protein contains ... 30 1.3 At5g57740.1 68418.m07218 zinc finger (C3HC4-type RING finger) fa... 30 1.7 At5g51160.1 68418.m06343 ankyrin repeat family protein contains ... 30 1.7 At2g43850.2 68415.m05452 ankyrin protein kinase, putative (APK1)... 30 1.7 At2g43850.1 68415.m05451 ankyrin protein kinase, putative (APK1)... 30 1.7 At5g14230.1 68418.m01663 ankyrin repeat family protein contains ... 29 2.2 At5g07270.1 68418.m00829 ankyrin repeat family protein contains ... 29 2.2 At1g60860.1 68414.m06851 ARF GTPase-activating domain-containing... 29 3.0 At1g09190.1 68414.m01026 pentatricopeptide (PPR) repeat-containi... 29 3.0 At5g61980.1 68418.m07779 ARF GTPase-activating domain-containing... 29 3.9 At5g60070.1 68418.m07532 ankyrin repeat family protein contains ... 29 3.9 At3g09550.1 68416.m01134 ankyrin repeat family protein contains ... 29 3.9 At5g65860.1 68418.m08289 ankyrin repeat family protein contains ... 28 5.2 At5g54070.1 68418.m06731 heat shock transcription factor family ... 28 5.2 At3g09890.1 68416.m01179 ankyrin repeat family protein contains ... 28 5.2 At4g14390.1 68417.m02219 ankyrin repeat family protein contains ... 28 6.8 At2g22300.1 68415.m02646 ethylene-responsive calmodulin-binding ... 28 6.8 At1g24330.1 68414.m03069 armadillo/beta-catenin repeat family pr... 28 6.8 At1g11740.1 68414.m01347 ankyrin repeat family protein contains ... 28 6.8 At4g39450.1 68417.m05582 expressed protein 27 9.0 At2g43030.1 68415.m05340 ribosomal protein L3 family protein con... 27 9.0 >At5g53470.1 68418.m06645 acyl-CoA binding protein, putative / ACBP, putative similar to acyl-CoA binding protein 2 [Arabidopsis thaliana] gi|12039034|gb|AAG46057 Length = 338 Score = 60.9 bits (141), Expect = 8e-10 Identities = 27/55 (49%), Positives = 34/55 (61%) Frame = -2 Query: 667 ELSGLFKQGTEGQCNTPKPGWLDGKGRRKWEAWKNLKDMPSEEAKEKYIALLKNM 503 +L GL+K TEG C P+P L R KW+AW+ L MP EEA EKYI L+ + Sbjct: 124 QLYGLYKIATEGPCTAPQPSALKMTARAKWQAWQKLGAMPPEEAMEKYIDLVTQL 178 Score = 42.3 bits (95), Expect = 3e-04 Identities = 21/53 (39%), Positives = 31/53 (58%), Gaps = 1/53 (1%) Frame = -3 Query: 243 AALSGGCPIDAVDECGQTALHYAVSCGHVESTKILTKAGA-TLLEDEEGNTPI 88 A + ++A D GQT+LHYAV C + L K A T ++DE+GN+P+ Sbjct: 269 ALVDKNADVNAKDNEGQTSLHYAVVCEREALAEFLVKQKADTTIKDEDGNSPL 321 Score = 37.1 bits (82), Expect = 0.011 Identities = 18/55 (32%), Positives = 29/55 (52%), Gaps = 1/55 (1%) Frame = -3 Query: 249 LSAALSGGCPIDAVDECGQTALHYAVSCGHVESTKILTKAGATL-LEDEEGNTPI 88 L + G P++A D G+T LH+A+ GH+ + L A + +D EG T + Sbjct: 234 LLKCIENGIPVNARDSEGRTPLHWAIDRGHLNVAEALVDKNADVNAKDNEGQTSL 288 >At4g27780.1 68417.m03990 acyl-CoA binding protein 2 (ACBP2) identical to acyl-CoA binding protein 2 [Arabidopsis thaliana] gi|12039034|gb|AAG46057 Length = 354 Score = 60.9 bits (141), Expect = 8e-10 Identities = 27/58 (46%), Positives = 35/58 (60%) Frame = -2 Query: 667 ELSGLFKQGTEGQCNTPKPGWLDGKGRRKWEAWKNLKDMPSEEAKEKYIALLKNMILT 494 +L GL+K TEG C P+P L R KW+AW+ L MP EEA EKYI ++ + T Sbjct: 134 QLYGLYKIATEGPCTAPQPSALKMTARAKWQAWQKLGAMPPEEAMEKYIEIVTQLYPT 191 Score = 44.0 bits (99), Expect = 1e-04 Identities = 20/55 (36%), Positives = 32/55 (58%), Gaps = 1/55 (1%) Frame = -3 Query: 249 LSAALSGGCPIDAVDECGQTALHYAVSCGHVESTKILTKAGATL-LEDEEGNTPI 88 L ++ G P++A D G+T LH+A+ GH+ K+L A + +D EG TP+ Sbjct: 249 LLKSIESGIPVNARDSEGRTPLHWAIDRGHLNIAKVLVDKNADVNAKDNEGQTPL 303 Score = 41.1 bits (92), Expect = 7e-04 Identities = 20/45 (44%), Positives = 27/45 (60%), Gaps = 1/45 (2%) Frame = -3 Query: 219 IDAVDECGQTALHYAVSCGHVESTKILTKAGA-TLLEDEEGNTPI 88 ++A D GQT LHYAV C + L K A T +DE+GN+P+ Sbjct: 292 VNAKDNEGQTPLHYAVVCDREAIAEFLVKQNANTAAKDEDGNSPL 336 >At4g24230.2 68417.m03478 acyl-CoA binding protein, putative / ACBP, putative contains similarity to acyl-CoA binding protein 2 [Arabidopsis thaliana] gi|12039034|gb|AAG46057 Length = 362 Score = 52.0 bits (119), Expect = 4e-07 Identities = 25/56 (44%), Positives = 32/56 (57%) Frame = -2 Query: 667 ELSGLFKQGTEGQCNTPKPGWLDGKGRRKWEAWKNLKDMPSEEAKEKYIALLKNMI 500 EL GL K TEG C +P + R KW AW+ L +M EEA E+Y+AL+ I Sbjct: 258 ELFGLHKIATEGSCREAQPMAVMISARAKWNAWQKLGNMSQEEAMEQYLALVSKEI 313 >At4g24230.1 68417.m03477 acyl-CoA binding protein, putative / ACBP, putative contains similarity to acyl-CoA binding protein 2 [Arabidopsis thaliana] gi|12039034|gb|AAG46057 Length = 364 Score = 52.0 bits (119), Expect = 4e-07 Identities = 25/56 (44%), Positives = 32/56 (57%) Frame = -2 Query: 667 ELSGLFKQGTEGQCNTPKPGWLDGKGRRKWEAWKNLKDMPSEEAKEKYIALLKNMI 500 EL GL K TEG C +P + R KW AW+ L +M EEA E+Y+AL+ I Sbjct: 258 ELFGLHKIATEGSCREAQPMAVMISARAKWNAWQKLGNMSQEEAMEQYLALVSKEI 313 >At1g31812.1 68414.m03905 acyl-CoA binding protein / ACBP identical to acyl-CoA-binding protein (ACBP) [Arabidopsis thaliana] SWISS-PROT:P57752 Length = 92 Score = 51.6 bits (118), Expect = 5e-07 Identities = 23/55 (41%), Positives = 32/55 (58%) Frame = -2 Query: 664 LSGLFKQGTEGQCNTPKPGWLDGKGRRKWEAWKNLKDMPSEEAKEKYIALLKNMI 500 L GL+KQ G +T +PG K R KW+AWK ++ SEEA YI +K ++ Sbjct: 29 LYGLYKQAKFGPVDTSRPGMFSMKERAKWDAWKAVEGKSSEEAMNDYITKVKQLL 83 >At3g05420.2 68416.m00594 acyl-CoA binding family protein similar to PIR|S68824|S68824 rngB protein, cytosolic (Dictyostelium discoideum); contains Pfam profiles PF00887: Acyl CoA binding protein, PF01344: Kelch motif Length = 669 Score = 48.8 bits (111), Expect = 3e-06 Identities = 21/52 (40%), Positives = 31/52 (59%) Frame = -2 Query: 664 LSGLFKQGTEGQCNTPKPGWLDGKGRRKWEAWKNLKDMPSEEAKEKYIALLK 509 L L++Q T G CNTPKP + KW++W+ L MPS EA ++ +L+ Sbjct: 47 LYALYQQATVGPCNTPKPSAWRPVEQSKWKSWQGLGTMPSIEAMRLFVKILE 98 >At3g05420.1 68416.m00593 acyl-CoA binding family protein similar to PIR|S68824|S68824 rngB protein, cytosolic (Dictyostelium discoideum); contains Pfam profiles PF00887: Acyl CoA binding protein, PF01344: Kelch motif Length = 668 Score = 48.8 bits (111), Expect = 3e-06 Identities = 21/52 (40%), Positives = 31/52 (59%) Frame = -2 Query: 664 LSGLFKQGTEGQCNTPKPGWLDGKGRRKWEAWKNLKDMPSEEAKEKYIALLK 509 L L++Q T G CNTPKP + KW++W+ L MPS EA ++ +L+ Sbjct: 47 LYALYQQATVGPCNTPKPSAWRPVEQSKWKSWQGLGTMPSIEAMRLFVKILE 98 >At5g27630.1 68418.m03310 acyl-CoA binding family protein similar to RING finger rngB protein, cytosolic - Dictyostelium discoideum, PIR:S68824; contains Pfam profiles PF01344: Kelch motif, PF00887: Acyl CoA binding protein (ACBP) Length = 648 Score = 43.2 bits (97), Expect = 2e-04 Identities = 21/69 (30%), Positives = 33/69 (47%) Frame = -2 Query: 655 LFKQGTEGQCNTPKPGWLDGKGRRKWEAWKNLKDMPSEEAKEKYIALLKNMILTGQVHLK 476 L +Q T G C+ PKP + + KW++W+ L MPS EA ++ +L+ Sbjct: 51 LHQQATLGPCSIPKPSAWNPVEQSKWKSWQGLGTMPSIEAMRLFVKILEEADPGWYPRTS 110 Query: 475 RQILIPRKH 449 +L P H Sbjct: 111 NSVLDPAVH 119 >At4g35450.4 68417.m05039 ankyrin repeat family protein / AFT protein (AFT) contains ankyrin repeats, Pfam:PF00023; identical to cDNA AFT protein (AFT) GI:3478699 Length = 304 Score = 41.1 bits (92), Expect = 7e-04 Identities = 22/55 (40%), Positives = 33/55 (60%), Gaps = 1/55 (1%) Frame = -3 Query: 249 LSAALSGGCPIDAVDECGQTALHYAVSCGHVESTKILTKAGATL-LEDEEGNTPI 88 L AAL+ G D D G+TALH+A G ++ ++L AGA++ D+ NTP+ Sbjct: 196 LKAALASGGNKDEEDSEGRTALHFACGYGELKCAQVLIDAGASVNAVDKNKNTPL 250 Score = 35.5 bits (78), Expect = 0.034 Identities = 18/51 (35%), Positives = 28/51 (54%), Gaps = 1/51 (1%) Frame = -3 Query: 237 LSGGCPIDAVDECGQTALHYAVSCGHVESTKILTKAGATL-LEDEEGNTPI 88 + G ++AVD+ T LHYA G E +L + GA + L++ + TPI Sbjct: 233 IDAGASVNAVDKNKNTPLHYAAGYGRKECVSLLLENGAAVTLQNLDEKTPI 283 >At4g35450.3 68417.m05038 ankyrin repeat family protein / AFT protein (AFT) contains ankyrin repeats, Pfam:PF00023; identical to cDNA AFT protein (AFT) GI:3478699 Length = 342 Score = 41.1 bits (92), Expect = 7e-04 Identities = 22/55 (40%), Positives = 33/55 (60%), Gaps = 1/55 (1%) Frame = -3 Query: 249 LSAALSGGCPIDAVDECGQTALHYAVSCGHVESTKILTKAGATL-LEDEEGNTPI 88 L AAL+ G D D G+TALH+A G ++ ++L AGA++ D+ NTP+ Sbjct: 234 LKAALASGGNKDEEDSEGRTALHFACGYGELKCAQVLIDAGASVNAVDKNKNTPL 288 Score = 35.5 bits (78), Expect = 0.034 Identities = 18/51 (35%), Positives = 28/51 (54%), Gaps = 1/51 (1%) Frame = -3 Query: 237 LSGGCPIDAVDECGQTALHYAVSCGHVESTKILTKAGATL-LEDEEGNTPI 88 + G ++AVD+ T LHYA G E +L + GA + L++ + TPI Sbjct: 271 IDAGASVNAVDKNKNTPLHYAAGYGRKECVSLLLENGAAVTLQNLDEKTPI 321 >At4g35450.2 68417.m05037 ankyrin repeat family protein / AFT protein (AFT) contains ankyrin repeats, Pfam:PF00023; identical to cDNA AFT protein (AFT) GI:3478699 Length = 342 Score = 41.1 bits (92), Expect = 7e-04 Identities = 22/55 (40%), Positives = 33/55 (60%), Gaps = 1/55 (1%) Frame = -3 Query: 249 LSAALSGGCPIDAVDECGQTALHYAVSCGHVESTKILTKAGATL-LEDEEGNTPI 88 L AAL+ G D D G+TALH+A G ++ ++L AGA++ D+ NTP+ Sbjct: 234 LKAALASGGNKDEEDSEGRTALHFACGYGELKCAQVLIDAGASVNAVDKNKNTPL 288 Score = 35.5 bits (78), Expect = 0.034 Identities = 18/51 (35%), Positives = 28/51 (54%), Gaps = 1/51 (1%) Frame = -3 Query: 237 LSGGCPIDAVDECGQTALHYAVSCGHVESTKILTKAGATL-LEDEEGNTPI 88 + G ++AVD+ T LHYA G E +L + GA + L++ + TPI Sbjct: 271 IDAGASVNAVDKNKNTPLHYAAGYGRKECVSLLLENGAAVTLQNLDEKTPI 321 >At4g35450.1 68417.m05036 ankyrin repeat family protein / AFT protein (AFT) contains ankyrin repeats, Pfam:PF00023; identical to cDNA AFT protein (AFT) GI:3478699 Length = 342 Score = 41.1 bits (92), Expect = 7e-04 Identities = 22/55 (40%), Positives = 33/55 (60%), Gaps = 1/55 (1%) Frame = -3 Query: 249 LSAALSGGCPIDAVDECGQTALHYAVSCGHVESTKILTKAGATL-LEDEEGNTPI 88 L AAL+ G D D G+TALH+A G ++ ++L AGA++ D+ NTP+ Sbjct: 234 LKAALASGGNKDEEDSEGRTALHFACGYGELKCAQVLIDAGASVNAVDKNKNTPL 288 Score = 35.5 bits (78), Expect = 0.034 Identities = 18/51 (35%), Positives = 28/51 (54%), Gaps = 1/51 (1%) Frame = -3 Query: 237 LSGGCPIDAVDECGQTALHYAVSCGHVESTKILTKAGATL-LEDEEGNTPI 88 + G ++AVD+ T LHYA G E +L + GA + L++ + TPI Sbjct: 271 IDAGASVNAVDKNKNTPLHYAAGYGRKECVSLLLENGAAVTLQNLDEKTPI 321 >At2g17390.1 68415.m02008 ankyrin repeat family protein contains ankyrin repeats, Pfam:PF00023 Length = 344 Score = 40.3 bits (90), Expect = 0.001 Identities = 23/55 (41%), Positives = 30/55 (54%), Gaps = 1/55 (1%) Frame = -3 Query: 249 LSAALSGGCPIDAVDECGQTALHYAVSCGHVESTKILTKAGATL-LEDEEGNTPI 88 L AAL+ G D D G+TALH+A G V ++L AGA D+ NTP+ Sbjct: 236 LKAALASGGNKDEEDSEGRTALHFACGYGEVRCAQVLLDAGANANAIDKNKNTPL 290 Score = 31.9 bits (69), Expect = 0.42 Identities = 15/47 (31%), Positives = 22/47 (46%) Frame = -3 Query: 237 LSGGCPIDAVDECGQTALHYAVSCGHVESTKILTKAGATLLEDEEGN 97 L G +A+D+ T LHYA G E +L + GA + + N Sbjct: 273 LDAGANANAIDKNKNTPLHYAAGYGRKECVSLLLENGAAVTQQNMDN 319 >At2g03430.1 68415.m00301 ankyrin repeat family protein contains ankyrin repeats, Pfam:PF00023 Length = 240 Score = 39.5 bits (88), Expect = 0.002 Identities = 20/51 (39%), Positives = 32/51 (62%), Gaps = 1/51 (1%) Frame = -3 Query: 237 LSGGCPIDAVDECGQTALHYAVSCGHVESTKILTKAGATL-LEDEEGNTPI 88 L+ G ++A + G+TALHYA S G +E ++L GA + + D+ G TP+ Sbjct: 103 LTRGADVNAKNNGGRTALHYAASKGRLEIAQLLLTHGAKINITDKVGCTPL 153 Score = 38.3 bits (85), Expect = 0.005 Identities = 20/46 (43%), Positives = 29/46 (63%), Gaps = 1/46 (2%) Frame = -3 Query: 228 GCPIDAVDECGQTALHYAVSCGHVESTKILTKAGATL-LEDEEGNT 94 G IDA D+ GQTAL ++V C + +L + GA + +ED+EG T Sbjct: 172 GAEIDATDKMGQTALMHSVICDDKQVAFLLIRHGADVDVEDKEGYT 217 >At5g02620.1 68418.m00198 ankyrin repeat family protein contains ankyrin repeat domains, Pfam:PF00023 Length = 524 Score = 37.5 bits (83), Expect = 0.008 Identities = 19/46 (41%), Positives = 28/46 (60%), Gaps = 2/46 (4%) Frame = -3 Query: 219 IDAVDECGQTALHYAVSCGHVESTKILTKAGATLLE--DEEGNTPI 88 + VD+ GQTALH AV + E +L +A +L+ D +GNTP+ Sbjct: 186 VTRVDKKGQTALHMAVKGQNTEIVDVLMEADGSLINSADNKGNTPL 231 >At2g25600.1 68415.m03066 potassium channel protein, putative similar to potassium channel [Lycopersicon esculentum] GI:8980432; member of the 1 pore, 6 transmembrane (1P/6TM- Shaker-type) K+ channel family, PMID:11500563; Shaker Pollen Inward K+ Channel (SPIK) PMID:11825875 Length = 888 Score = 37.5 bits (83), Expect = 0.008 Identities = 25/60 (41%), Positives = 29/60 (48%), Gaps = 1/60 (1%) Frame = -3 Query: 267 QKCNYALSAALSGGCPIDAVDECGQTALHYAVSCGHVESTKILTKAGATL-LEDEEGNTP 91 + C AL + G + D G TALH AVS GH+E K L GA L D G TP Sbjct: 651 KNCLDALKDIIKYGGDVTLPDGNGTTALHRAVSEGHLEIVKFLLDQGADLDWPDSYGWTP 710 Score = 32.3 bits (70), Expect = 0.32 Identities = 20/55 (36%), Positives = 28/55 (50%), Gaps = 1/55 (1%) Frame = -3 Query: 249 LSAALSGGCPIDAVDECGQTALHYAVSCGHVESTKILTKAGA-TLLEDEEGNTPI 88 L L G + +D+ G+TALH A S G +L + GA + D EGN P+ Sbjct: 560 LHQLLRRGSSPNEMDKDGRTALHIAASKGSHYCVVLLLEHGADPNIRDSEGNVPL 614 >At3g01750.1 68416.m00112 ankyrin repeat family protein contains ankyrin repeats, Pfam:PF00023 Length = 664 Score = 35.5 bits (78), Expect = 0.034 Identities = 18/50 (36%), Positives = 27/50 (54%), Gaps = 2/50 (4%) Frame = -3 Query: 219 IDAVDECGQTALHYAVSCGHVESTKILTKAGATLL--EDEEGNTPIRPGL 76 +DAVD G TALH A GH + +L A +L+ + G+T + G+ Sbjct: 252 VDAVDNQGNTALHVAAYRGHADLVDVLISASPSLISARNNAGDTFLHAGI 301 >At3g04710.1 68416.m00505 ankyrin repeat family protein contains Pfam profile: PF00023 ankyrin repeat Length = 456 Score = 35.1 bits (77), Expect = 0.045 Identities = 17/50 (34%), Positives = 23/50 (46%) Frame = -3 Query: 237 LSGGCPIDAVDECGQTALHYAVSCGHVESTKILTKAGATLLEDEEGNTPI 88 L G + E G TALH+A G +E K L G + + E TP+ Sbjct: 109 LEQGADPNIASELGATALHHAAGTGEIELLKELLSRGVPVDSESESGTPL 158 >At4g19150.1 68417.m02825 ankyrin repeat family protein contains ankyrin repeats, Pfam:PF00023 Length = 243 Score = 33.9 bits (74), Expect = 0.10 Identities = 16/40 (40%), Positives = 21/40 (52%) Frame = -3 Query: 237 LSGGCPIDAVDECGQTALHYAVSCGHVESTKILTKAGATL 118 LS G + ++ G T LHYA H E K L K GA++ Sbjct: 103 LSAGGSVKSITRKGLTPLHYAAQGSHFEIVKYLVKKGASV 142 >At3g03790.2 68416.m00389 ankyrin repeat family protein / regulator of chromosome condensation (RCC1) family protein similar to hect domain and RLD 2 GB:NP_004658 [Homo sapiens]; contains Pfam PF00415: Regulator of chromosome condensation (RCC1); contains Pfam PF00023: Ankyrin repeat; similar to rjs (GI:3414809) [Mus musculus]; similar to HERC2 (GI:4079809) [Homo sapiens] Length = 1081 Score = 33.5 bits (73), Expect = 0.14 Identities = 20/52 (38%), Positives = 30/52 (57%), Gaps = 2/52 (3%) Frame = -3 Query: 237 LSGGCPIDAVD-ECGQTALHYAVSCGHVESTKILTKAGATL-LEDEEGNTPI 88 L+ G DA D E G ++LH A+ GH+ +L +GA+ LED + TP+ Sbjct: 82 LAAGADPDARDGESGWSSLHRALHFGHLAVASVLIDSGASFTLEDIKLRTPV 133 >At3g03790.1 68416.m00388 ankyrin repeat family protein / regulator of chromosome condensation (RCC1) family protein similar to hect domain and RLD 2 GB:NP_004658 [Homo sapiens]; contains Pfam PF00415: Regulator of chromosome condensation (RCC1); contains Pfam PF00023: Ankyrin repeat; similar to rjs (GI:3414809) [Mus musculus]; similar to HERC2 (GI:4079809) [Homo sapiens] Length = 1078 Score = 33.5 bits (73), Expect = 0.14 Identities = 20/52 (38%), Positives = 30/52 (57%), Gaps = 2/52 (3%) Frame = -3 Query: 237 LSGGCPIDAVD-ECGQTALHYAVSCGHVESTKILTKAGATL-LEDEEGNTPI 88 L+ G DA D E G ++LH A+ GH+ +L +GA+ LED + TP+ Sbjct: 82 LAAGADPDARDGESGWSSLHRALHFGHLAVASVLIDSGASFTLEDIKLRTPV 133 >At2g31800.1 68415.m03882 ankyrin protein kinase, putative similar to ankyrin-kinase [Medicago truncatula] gi|18700701|gb|AAL78674; contains Pfam profile PF00023: Ankyrin repeat; identical to cDNA calcineurin B-like protein 10 (CBL10) GI:29150247; blastp match of 67% identity and 1.9e-200 P-value to GP|18700701|gb|AAL78674.1|AF458699_1|AF458699 ankyrin-kinase {Medicago truncatula} Length = 476 Score = 33.5 bits (73), Expect = 0.14 Identities = 18/49 (36%), Positives = 27/49 (55%), Gaps = 1/49 (2%) Frame = -3 Query: 237 LSGGCPIDAVDECGQTALHYAVSCGHVESTKILTKAGATL-LEDEEGNT 94 L G ++++D G+TALH A GHV+ K+L A + D G+T Sbjct: 95 LDEGIDVNSIDLDGRTALHIAACEGHVDVVKLLLTRKANIDARDRWGST 143 >At2g47450.1 68415.m05922 chloroplast signal recognition particle component (CAO) nearly identical to CAO [Arabidopsis thaliana] GI:4102582 Length = 373 Score = 33.1 bits (72), Expect = 0.18 Identities = 15/34 (44%), Positives = 22/34 (64%) Frame = -3 Query: 219 IDAVDECGQTALHYAVSCGHVESTKILTKAGATL 118 +DAVDE G+TAL + G + ++L +AGA L Sbjct: 153 VDAVDENGRTALLFVAGLGSDKCVRLLAEAGADL 186 >At5g12320.1 68418.m01448 ankyrin repeat family protein contains ankyrin repeats, Pfam:PF00023 Length = 144 Score = 32.7 bits (71), Expect = 0.24 Identities = 17/40 (42%), Positives = 24/40 (60%) Frame = -3 Query: 237 LSGGCPIDAVDECGQTALHYAVSCGHVESTKILTKAGATL 118 +S G I+A+++ LH+A GHVE K L AGA+L Sbjct: 64 ISEGVDINALNDENNAPLHWACLNGHVEVVKRLILAGASL 103 Score = 31.5 bits (68), Expect = 0.56 Identities = 17/55 (30%), Positives = 27/55 (49%), Gaps = 1/55 (1%) Frame = -3 Query: 249 LSAALSGGCPIDAVDECGQTALHYAVSCGHVESTKILTKAGATL-LEDEEGNTPI 88 L S G + + D G+TALH A + GH+ + L G + ++E N P+ Sbjct: 27 LRTLASDGLSLHSRDSQGRTALHMAAANGHMTIVEYLISEGVDINALNDENNAPL 81 >At3g12360.1 68416.m01541 ankyrin repeat family protein contains ankyrin repeat domains, Pfam:PF00023 Length = 590 Score = 32.7 bits (71), Expect = 0.24 Identities = 19/43 (44%), Positives = 26/43 (60%) Frame = -1 Query: 401 HNELSLLDAAREDCGERVKELLIKKPELKYEKDEDGLTALHWA 273 +N+ +L AAR+ E +K LL K P+L D+ G TALH A Sbjct: 231 NNKNALHLAARQGHVEVIKALLSKDPQLARRIDKKGQTALHMA 273 >At1g10870.1 68414.m01249 ARF GTPase-activating domain-containing protein Length = 775 Score = 32.3 bits (70), Expect = 0.32 Identities = 18/51 (35%), Positives = 28/51 (54%), Gaps = 1/51 (1%) Frame = -3 Query: 249 LSAALSGGCPIDAVDECGQTALHYAVSCGHVESTKILTKAGA-TLLEDEEG 100 L L G ++ D G+T LH+ +S G+ + KIL + GA +ED+ G Sbjct: 699 LELLLQFGADLNIRDYHGRTPLHHCISSGNHKFAKILLRRGARPSIEDDGG 749 >At3g59830.1 68416.m06676 ankyrin protein kinase, putative similar to ankyrin-kinase [Medicago truncatula] gi|18700701|gb|AAL78674 Length = 477 Score = 31.9 bits (69), Expect = 0.42 Identities = 17/49 (34%), Positives = 27/49 (55%), Gaps = 1/49 (2%) Frame = -3 Query: 237 LSGGCPIDAVDECGQTALHYAVSCGHVESTKILTKAGATL-LEDEEGNT 94 L+ G ++++D G+TALH A GH + K+L A + D G+T Sbjct: 96 LNEGIDVNSIDLDGRTALHIASCEGHYDVVKVLLSRRANIDARDRWGST 144 >At2g04740.1 68415.m00484 ankyrin repeat family protein contains ankyrin repeats, Pfam:PF00023 Length = 578 Score = 31.9 bits (69), Expect = 0.42 Identities = 14/39 (35%), Positives = 22/39 (56%) Frame = -3 Query: 228 GCPIDAVDECGQTALHYAVSCGHVESTKILTKAGATLLE 112 G ++A D AL+YA GH++S ++L + GA E Sbjct: 59 GVNVNARDRWDSVALYYACLAGHIDSARLLLENGAICSE 97 >At5g20350.1 68418.m02421 zinc finger (DHHC type) family protein / ankyrin repeat family protein similar to patsas protein [Drosophila melanogaster] GI:6002770; contains Pfam profiles PF00023: Ankyrin repeat, PF01529: DHHC zinc finger domain Length = 592 Score = 31.5 bits (68), Expect = 0.56 Identities = 13/35 (37%), Positives = 22/35 (62%) Frame = -3 Query: 228 GCPIDAVDECGQTALHYAVSCGHVESTKILTKAGA 124 G ++A D GQTALH++ G ++ ++L + GA Sbjct: 88 GGDVNATDHTGQTALHWSAVRGAIQVAELLLQEGA 122 >At3g11340.1 68416.m01379 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 447 Score = 31.1 bits (67), Expect = 0.73 Identities = 15/48 (31%), Positives = 28/48 (58%) Frame = -3 Query: 144 ILTKAGATLLEDEEGNTPIRPGLLILEIKEISWKVLMDPRAAEFLQPG 1 +L + G L++ + ++P+ P L L +K++ W DPR+ + LQ G Sbjct: 145 VLREKGYLSLQETKADSPV-PELPYLRMKDLPWFQTEDPRSGDKLQIG 191 >At2g31820.1 68415.m03886 ankyrin repeat family protein contains ankyrin repeat domains, Pfam:PF00023 Length = 662 Score = 31.1 bits (67), Expect = 0.73 Identities = 17/43 (39%), Positives = 24/43 (55%) Frame = -1 Query: 401 HNELSLLDAAREDCGERVKELLIKKPELKYEKDEDGLTALHWA 273 + + +L AAR E VK L+ K P + + D+ G TALH A Sbjct: 291 NGKTALHSAARMGHVEVVKSLIGKDPSIGFRTDKKGQTALHMA 333 Score = 29.9 bits (64), Expect = 1.7 Identities = 18/42 (42%), Positives = 23/42 (54%), Gaps = 2/42 (4%) Frame = -3 Query: 207 DECGQTALHYAVSCGHVESTKILTKAGATLL--EDEEGNTPI 88 D+ GQTALH AV + L K +L ED +GNTP+ Sbjct: 323 DKKGQTALHMAVKGQNDGIVVELVKPDVAVLSVEDNKGNTPL 364 >At1g07710.1 68414.m00831 ankyrin repeat family protein contains ankyrin repeat domains, Pfam:PF00023 Length = 543 Score = 31.1 bits (67), Expect = 0.73 Identities = 18/43 (41%), Positives = 26/43 (60%), Gaps = 2/43 (4%) Frame = -3 Query: 210 VDECGQTALHYAVSCGHVESTKILTKAGATLLE--DEEGNTPI 88 +D+ GQTALH AV +VE + L KA + + D +GNT + Sbjct: 199 MDKKGQTALHMAVKGTNVEVVEELIKADRSSINIADTKGNTAL 241 Score = 28.3 bits (60), Expect = 5.2 Identities = 19/66 (28%), Positives = 28/66 (42%), Gaps = 2/66 (3%) Frame = -3 Query: 210 VDECGQTALHYAVSCGHVESTKILTKAGATL--LEDEEGNTPIRPGLLILEIKEISWKVL 37 VD TALH A + GH E L + G++L + G T + +K I + Sbjct: 131 VDLSNTTALHTAATQGHTEVVNFLLELGSSLAGIAKSNGKTALHSASRNGHVKVIKALLA 190 Query: 36 MDPRAA 19 +P A Sbjct: 191 SEPAIA 196 >At4g32500.1 68417.m04626 potassium channel protein, putative similar to potassium channel [Solanum tuberosum] gi|1514649|emb|CAA60016; similar to AKT1 [Arabidopsis thaliana] gi|563112|gb|AAA96810; member of the 1 pore, 6 transmembrane (1P/6TM- Shaker-type) K+ channel family, PMID:11500563 Length = 880 Score = 30.3 bits (65), Expect = 1.3 Identities = 19/55 (34%), Positives = 27/55 (49%), Gaps = 1/55 (1%) Frame = -3 Query: 249 LSAALSGGCPIDAVDECGQTALHYAVSCGHVESTKILTKAGA-TLLEDEEGNTPI 88 L L G + D+ G+TALH A S G +L + GA + D EG+ P+ Sbjct: 558 LHQLLKRGSNPNETDKNGRTALHIAASKGSQYCVVLLLEHGADPNIRDSEGSVPL 612 Score = 30.3 bits (65), Expect = 1.3 Identities = 18/45 (40%), Positives = 24/45 (53%) Frame = -3 Query: 252 ALSAALSGGCPIDAVDECGQTALHYAVSCGHVESTKILTKAGATL 118 AL + G I D G TALH AVS G++E + L + GA + Sbjct: 654 ALKDIVKYGGDISLSDVNGTTALHRAVSEGNLEIVQFLLEKGADM 698 >At4g03450.1 68417.m00472 ankyrin repeat family protein contains ankyrin repeats, Pfam domain PF00023 Length = 641 Score = 30.3 bits (65), Expect = 1.3 Identities = 15/39 (38%), Positives = 23/39 (58%), Gaps = 2/39 (5%) Frame = -3 Query: 198 GQTALHYAVSCGHVESTKILTKAG--ATLLEDEEGNTPI 88 G TALH A+ GH+++ L KA A+ L + G +P+ Sbjct: 153 GNTALHLALKGGHLKTAACLVKANHLASFLANNHGVSPL 191 >At2g01680.1 68415.m00095 ankyrin repeat family protein contains ankyrin repeat domains, Pfam:PF00023 Length = 532 Score = 30.3 bits (65), Expect = 1.3 Identities = 17/42 (40%), Positives = 25/42 (59%), Gaps = 2/42 (4%) Frame = -3 Query: 207 DECGQTALHYAVSCGHVESTKILTKAGATLL--EDEEGNTPI 88 D+ GQTALH AV +E + + +A T+L D +GNT + Sbjct: 193 DKKGQTALHMAVKGRSLEVVEEILQADYTILNERDRKGNTAL 234 >At1g05640.1 68414.m00585 ankyrin repeat family protein contains ankyrin repeat domains, Pfam:PF00023 Length = 627 Score = 30.3 bits (65), Expect = 1.3 Identities = 18/42 (42%), Positives = 23/42 (54%), Gaps = 2/42 (4%) Frame = -3 Query: 207 DECGQTALHYAVSCGHVESTKILTKAGATLL--EDEEGNTPI 88 D+ GQTALH AV + L K +L ED +GNTP+ Sbjct: 287 DKKGQTALHMAVKGQNEGIVLELVKPDPAILSVEDSKGNTPL 328 Score = 30.3 bits (65), Expect = 1.3 Identities = 14/40 (35%), Positives = 23/40 (57%) Frame = -3 Query: 228 GCPIDAVDECGQTALHYAVSCGHVESTKILTKAGATLLED 109 G ++A+++ G TAL A G+ E +L +AGA +D Sbjct: 348 GINLNAMNKAGDTALDIAEKIGNPELVSVLKEAGAATAKD 387 >At5g57740.1 68418.m07218 zinc finger (C3HC4-type RING finger) family protein / ankyrin repeat family protein contains Pfam profile: PF00097 zinc finger, C3HC4 type (RING finger) and Pfam profile: PF00023 ankyrin repeat Length = 508 Score = 29.9 bits (64), Expect = 1.7 Identities = 18/48 (37%), Positives = 25/48 (52%), Gaps = 1/48 (2%) Frame = -3 Query: 228 GCPIDAVDECGQTALHYAVSCGHVESTKILTKAGATLLE-DEEGNTPI 88 G ID + G TALHYA G+ + ++L GA L + G TP+ Sbjct: 212 GTTIDLIG-AGSTALHYASCGGNTQCCQLLISKGACLAAVNSNGWTPM 258 >At5g51160.1 68418.m06343 ankyrin repeat family protein contains ankyrin repeats, Pfam:PF00023 Length = 442 Score = 29.9 bits (64), Expect = 1.7 Identities = 17/54 (31%), Positives = 28/54 (51%), Gaps = 2/54 (3%) Frame = -3 Query: 207 DECGQTALHYAVSCGHVESTKILTKAGATLLEDE--EGNTPIRPGLLILEIKEI 52 D G+T LH A G ++ + + + LEDE +G T + +L LEI+ + Sbjct: 78 DRDGKTPLHVATMRGKIDVIREIVASCVDCLEDETVQGQTALHLAVLHLEIEAV 131 >At2g43850.2 68415.m05452 ankyrin protein kinase, putative (APK1) similar to ankyrin-kinase [Medicago truncatula] gi|18700701|gb|AAL78674;contains Pfam profile PF00069: Protein kinase domain; contains Pfam profile PF00023: Ankyrin repeat Length = 479 Score = 29.9 bits (64), Expect = 1.7 Identities = 17/49 (34%), Positives = 25/49 (51%), Gaps = 1/49 (2%) Frame = -3 Query: 237 LSGGCPIDAVDECGQTALHYAVSCGHVESTKILTKAGATL-LEDEEGNT 94 L G ++++D G+TALH A GH+ K L A + D G+T Sbjct: 98 LDEGIDVNSIDLDGRTALHIAACEGHLGVVKALLSRRANIDARDRWGST 146 >At2g43850.1 68415.m05451 ankyrin protein kinase, putative (APK1) similar to ankyrin-kinase [Medicago truncatula] gi|18700701|gb|AAL78674;contains Pfam profile PF00069: Protein kinase domain; contains Pfam profile PF00023: Ankyrin repeat Length = 479 Score = 29.9 bits (64), Expect = 1.7 Identities = 17/49 (34%), Positives = 25/49 (51%), Gaps = 1/49 (2%) Frame = -3 Query: 237 LSGGCPIDAVDECGQTALHYAVSCGHVESTKILTKAGATL-LEDEEGNT 94 L G ++++D G+TALH A GH+ K L A + D G+T Sbjct: 98 LDEGIDVNSIDLDGRTALHIAACEGHLGVVKALLSRRANIDARDRWGST 146 >At5g14230.1 68418.m01663 ankyrin repeat family protein contains ankyrin repeats, Pfam:PF00023 Length = 591 Score = 29.5 bits (63), Expect = 2.2 Identities = 17/45 (37%), Positives = 26/45 (57%), Gaps = 1/45 (2%) Frame = -3 Query: 219 IDAVDECGQTALHYAVSCGHVESTKILTKAGATL-LEDEEGNTPI 88 +D DE G +A A GHVE+ ++L AGA + L + G+T + Sbjct: 311 LDYQDEEGFSAAMLAAMNGHVEAFRVLVYAGADVKLYNNSGDTVV 355 Score = 29.1 bits (62), Expect = 3.0 Identities = 13/35 (37%), Positives = 20/35 (57%) Frame = -3 Query: 228 GCPIDAVDECGQTALHYAVSCGHVESTKILTKAGA 124 GC I++ ++ G TAL ++ H E K+L GA Sbjct: 204 GCDINSKNDVGNTALLISIKHKHPECVKVLALDGA 238 Score = 28.3 bits (60), Expect = 5.2 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = -3 Query: 198 GQTALHYAVSCGHVESTKILTKAGA 124 G+T LH+AV CG+ + +L GA Sbjct: 144 GRTLLHHAVLCGNKAAVSVLLDCGA 168 >At5g07270.1 68418.m00829 ankyrin repeat family protein contains ankyrin repeats, Pfam:PF00023 Length = 513 Score = 29.5 bits (63), Expect = 2.2 Identities = 18/59 (30%), Positives = 27/59 (45%), Gaps = 2/59 (3%) Frame = -3 Query: 258 NYALSAALSGGCPIDAVDECGQTALHYAVSCGH--VESTKILTKAGATLLEDEEGNTPI 88 N + L G +++ + CGQTAL A GH V T +L + T + G T + Sbjct: 58 NEIVGLLLENGADVNSRNYCGQTALMQACRYGHWEVVQTLLLFRCNVTRADYLAGRTAL 116 >At1g60860.1 68414.m06851 ARF GTPase-activating domain-containing protein Length = 776 Score = 29.1 bits (62), Expect = 3.0 Identities = 17/51 (33%), Positives = 26/51 (50%), Gaps = 1/51 (1%) Frame = -3 Query: 249 LSAALSGGCPIDAVDECGQTALHYAVSCGHVESTKILTKAGA-TLLEDEEG 100 L L G I+ D G+T LH+ ++ G+ K+L + GA +ED G Sbjct: 700 LELLLQFGADINMRDYHGRTPLHHCIASGNNAFAKVLLRRGARPSIEDGGG 750 >At1g09190.1 68414.m01026 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 999 Score = 29.1 bits (62), Expect = 3.0 Identities = 15/46 (32%), Positives = 21/46 (45%) Frame = -3 Query: 249 LSAALSGGCPIDAVDECGQTALHYAVSCGHVESTKILTKAGATLLE 112 L + GG V +CG L ++ GHV T++ K G L E Sbjct: 145 LCVDIGGGSTEFVVGKCGDVKLAVSLKLGHVNLTQMFMKNGIGLKE 190 >At5g61980.1 68418.m07779 ARF GTPase-activating domain-containing protein similar to GCN4-complementing protein (GCP1) GI:6465806 from [Arabidopsis thaliana] Length = 850 Score = 28.7 bits (61), Expect = 3.9 Identities = 15/52 (28%), Positives = 27/52 (51%), Gaps = 1/52 (1%) Frame = -3 Query: 237 LSGGCPIDAVDECGQTALHYA-VSCGHVESTKILTKAGATLLEDEEGNTPIR 85 L G I+A D G+T LH+ +S + + +L + G D++ N P++ Sbjct: 778 LQYGAKINATDSKGRTPLHHCIISRRYAIARLLLMRGGDPNAVDKDSNIPVK 829 >At5g60070.1 68418.m07532 ankyrin repeat family protein contains ankyrin repeat domains, Pfam:PF00023 Length = 548 Score = 28.7 bits (61), Expect = 3.9 Identities = 20/59 (33%), Positives = 29/59 (49%), Gaps = 3/59 (5%) Frame = -3 Query: 255 YALSAALSGGCPIDAVDEC-GQTALHYAVSCGHVESTK--ILTKAGATLLEDEEGNTPI 88 Y L AA G + A+ + G+TALH A GH E K + + D++G TP+ Sbjct: 160 YLLEAA---GSSLAAIAKSNGKTALHSAARNGHAEVVKAIVAVEPDTATRTDKKGQTPL 215 Score = 27.5 bits (58), Expect = 9.0 Identities = 14/32 (43%), Positives = 18/32 (56%) Frame = -3 Query: 210 VDECGQTALHYAVSCGHVESTKILTKAGATLL 115 VD TALH A + GHVE + L +A + L Sbjct: 138 VDLSNTTALHTAAAQGHVEVVEYLLEAAGSSL 169 >At3g09550.1 68416.m01134 ankyrin repeat family protein contains ankyrin repeat domains, Pfam:PF00023 Length = 436 Score = 28.7 bits (61), Expect = 3.9 Identities = 15/35 (42%), Positives = 21/35 (60%) Frame = -1 Query: 377 AAREDCGERVKELLIKKPELKYEKDEDGLTALHWA 273 AAR+ + V+ LL K P+L D+ G T+LH A Sbjct: 82 AARQGHVDIVRTLLDKDPQLARRTDKKGQTSLHMA 116 >At5g65860.1 68418.m08289 ankyrin repeat family protein contains ankyrin repeats, Pfam:PF00023 Length = 346 Score = 28.3 bits (60), Expect = 5.2 Identities = 13/41 (31%), Positives = 22/41 (53%) Frame = -3 Query: 249 LSAALSGGCPIDAVDECGQTALHYAVSCGHVESTKILTKAG 127 ++A L G P +A+ +A +A+ GH E+ +L K G Sbjct: 72 VTALLESGAPWNALSPSNLSAGDFAMEAGHQETFDLLLKTG 112 >At5g54070.1 68418.m06731 heat shock transcription factor family protein contains Pfam profile: PF00447 HSF-type DNA-binding domain Length = 331 Score = 28.3 bits (60), Expect = 5.2 Identities = 13/44 (29%), Positives = 25/44 (56%) Frame = -1 Query: 518 FVEKYDPDWSGTPQKTNIDTKETWVAVSSMRYSPEPDLVHNELS 387 FV+K QK +D + ++A+++ ++PEPD++ N S Sbjct: 260 FVKKLKLLQDQETQKNLLDVEREFMAMAATEHNPEPDILVNNQS 303 >At3g09890.1 68416.m01179 ankyrin repeat family protein contains ankyrin repeats, Pfam:PF00023 Length = 206 Score = 28.3 bits (60), Expect = 5.2 Identities = 15/44 (34%), Positives = 23/44 (52%), Gaps = 1/44 (2%) Frame = -3 Query: 219 IDAVDECGQTALHYAVSCGHVESTKILTKAGAT-LLEDEEGNTP 91 I+ D G T LH+A HV+ + L +GA+ ++ G TP Sbjct: 139 IETADIEGDTPLHHAARGEHVDVVRFLLGSGASPTTQNSYGKTP 182 >At4g14390.1 68417.m02219 ankyrin repeat family protein contains Pfam profile: PF00023 ankyrin repeat Length = 694 Score = 27.9 bits (59), Expect = 6.8 Identities = 17/59 (28%), Positives = 29/59 (49%), Gaps = 4/59 (6%) Frame = -3 Query: 210 VDECGQTALHYAVSCGH--VESTKILTKAGATLL--EDEEGNTPIRPGLLILEIKEISW 46 +++ GQ LH A G + + I+ K L +D +GNTP+ ++ K I+W Sbjct: 389 LNKLGQNVLHIAAKNGKFWISNMLIINKDTEHLGVGQDVDGNTPLHLAVMNWHFKSITW 447 >At2g22300.1 68415.m02646 ethylene-responsive calmodulin-binding protein, putative (SR1) identical to partial sequence of ethylene-induced calmodulin-binding protein GI:11545505 from [Arabidopsis thaliana]; contains Pfam profiles PF03859: CG-1 domain, PF00612: IQ calmodulin-binding motif, and PF00023: Ankyrin repeat Length = 1032 Score = 27.9 bits (59), Expect = 6.8 Identities = 16/45 (35%), Positives = 20/45 (44%) Frame = -3 Query: 258 NYALSAALSGGCPIDAVDECGQTALHYAVSCGHVESTKILTKAGA 124 N+AL + G +D D G TALH+A G L GA Sbjct: 675 NWALEPTIIAGVSVDFRDVNGWTALHWAAFFGRERIIGSLIALGA 719 >At1g24330.1 68414.m03069 armadillo/beta-catenin repeat family protein / U-box domain-containing family protein contains Pfam domain, PF00514: Armadillo/beta-catenin-like repeats and Pfam, PF04564: U-box domain Length = 771 Score = 27.9 bits (59), Expect = 6.8 Identities = 17/53 (32%), Positives = 27/53 (50%) Frame = -1 Query: 410 DLVHNELSLLDAAREDCGERVKELLIKKPELKYEKDEDGLTALHWAADRNAIT 252 +L H + LLD + ++ G+R+ LL + + D L H AA R +IT Sbjct: 122 ELEHTKF-LLDPSEKEVGDRIIALLQQGKKFDNGSDSTELEIFHQAATRLSIT 173 >At1g11740.1 68414.m01347 ankyrin repeat family protein contains ankyrin repeats, Pfam domain PF00023 Length = 624 Score = 27.9 bits (59), Expect = 6.8 Identities = 19/57 (33%), Positives = 29/57 (50%), Gaps = 1/57 (1%) Frame = -3 Query: 198 GQTALHYAVSCGHVESTKILTKAGATL-LEDEEGNTPIRPGLLILEIKEISWKVLMD 31 G+T LH AV G V + K ++ AGA + L++ G + L EI+ +L D Sbjct: 78 GETPLHLAVRLGDVFAAKTISSAGADITLQNAAGWNSLHEA-LCRRNSEITEAILRD 133 >At4g39450.1 68417.m05582 expressed protein Length = 1553 Score = 27.5 bits (58), Expect = 9.0 Identities = 15/44 (34%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Frame = -1 Query: 440 VSSMRYSPEPDLVHNELSLLDAAREDCGE-RVKELLIKKPELKY 312 + SMRY E VH + + AR+ CG+ + L I+ P+ K+ Sbjct: 1343 LDSMRYYIEAAEVHTSIDAGNKARKACGQASLVSLQIRMPDSKW 1386 >At2g43030.1 68415.m05340 ribosomal protein L3 family protein contains Pfam profile PF00297: ribosomal protein L3 Length = 271 Score = 27.5 bits (58), Expect = 9.0 Identities = 15/41 (36%), Positives = 24/41 (58%) Frame = -3 Query: 645 KVLKVNATLQSLDG*MVKDVGNGRPGRILKICPVKRLRRNI 523 K++KV+ L + M+K G+PG +L+I P K + NI Sbjct: 231 KIVKVDKELNVV---MIKGALPGKPGNLLRITPAKIVGVNI 268 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,069,130 Number of Sequences: 28952 Number of extensions: 345337 Number of successful extensions: 1074 Number of sequences better than 10.0: 56 Number of HSP's better than 10.0 without gapping: 962 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1072 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1496852856 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -