BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0258 (599 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC1734.06 |rhp18||Rad18 homolog Rhp18|Schizosaccharomyces pomb... 27 2.1 SPBC19F5.05c |ppp1|SPBC25D12.01c|pescadillo-family BRCT domain p... 26 4.8 >SPBC1734.06 |rhp18||Rad18 homolog Rhp18|Schizosaccharomyces pombe|chr 2|||Manual Length = 387 Score = 27.1 bits (57), Expect = 2.1 Identities = 12/38 (31%), Positives = 22/38 (57%) Frame = -2 Query: 478 DQHTNSTLNRQRTPSGSTTPVRSGQQTAVSRLLRKPSD 365 +QH +S LN +PS S++P ++ + + LL +D Sbjct: 172 NQHLDSCLNSPSSPSSSSSPYKNKDNSKSNSLLSFKTD 209 >SPBC19F5.05c |ppp1|SPBC25D12.01c|pescadillo-family BRCT domain protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 607 Score = 25.8 bits (54), Expect = 4.8 Identities = 13/42 (30%), Positives = 20/42 (47%) Frame = -2 Query: 496 RIPVLKDQHTNSTLNRQRTPSGSTTPVRSGQQTAVSRLLRKP 371 RI +LK + N+++ GST PV + LL +P Sbjct: 35 RICILKGVYPREPKNKKKANKGSTAPVTFYYTKDIQYLLHEP 76 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,068,112 Number of Sequences: 5004 Number of extensions: 36558 Number of successful extensions: 91 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 86 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 91 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 262236260 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -