BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0255 (712 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB023025-1|BAA74592.1| 133|Apis mellifera actin protein. 132 4e-33 EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. 22 6.6 EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. 22 6.6 AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 22 6.6 >AB023025-1|BAA74592.1| 133|Apis mellifera actin protein. Length = 133 Score = 132 bits (318), Expect = 4e-33 Identities = 73/114 (64%), Positives = 81/114 (71%), Gaps = 4/114 (3%) Frame = -1 Query: 652 TMENERFPLPRGFLPTLVLGYESLR-HPRDHI*LHH---EVRRGHP*GLVRQTVLSGGTT 485 T+ NERF P LG E+ H + + ++R+ L TVLSGGTT Sbjct: 24 TIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKD----LYANTVLSGGTT 79 Query: 484 MYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWIS 323 MYPGIADRMQKEITALAPSTMKIKIIAPPE+KYSVWIGGSILASLSTFQQMWIS Sbjct: 80 MYPGIADRMQKEITALAPSTMKIKIIAPPEKKYSVWIGGSILASLSTFQQMWIS 133 Score = 28.3 bits (60), Expect = 0.076 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = -3 Query: 692 LKKSYELPAGQVIHYGKRKIPVAQRL 615 L+KSYELP GQVI G + + L Sbjct: 11 LEKSYELPDGQVITIGNERFRCPEAL 36 >EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. Length = 684 Score = 21.8 bits (44), Expect = 6.6 Identities = 7/18 (38%), Positives = 12/18 (66%) Frame = -3 Query: 506 RIVRWYHHVPWNRRPYAK 453 RI+ +YH +++PY K Sbjct: 424 RIIDYYHSYKMHQKPYNK 441 >EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. Length = 684 Score = 21.8 bits (44), Expect = 6.6 Identities = 7/18 (38%), Positives = 12/18 (66%) Frame = -3 Query: 506 RIVRWYHHVPWNRRPYAK 453 RI+ +YH +++PY K Sbjct: 424 RIIDYYHSYKMHQKPYNK 441 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 21.8 bits (44), Expect = 6.6 Identities = 8/20 (40%), Positives = 9/20 (45%) Frame = +2 Query: 566 VSWMPQAFIPKNEGWKKASG 625 + W AFIP N W G Sbjct: 561 IEWFDYAFIPGNLKWLDIHG 580 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 218,024 Number of Sequences: 438 Number of extensions: 5241 Number of successful extensions: 13 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21926700 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -