BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0254 (679 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY462096-1|AAS21248.1| 603|Anopheles gambiae transposase protein. 50 9e-08 AB090822-2|BAC57920.1| 1173|Anopheles gambiae reverse transcript... 23 6.7 >AY462096-1|AAS21248.1| 603|Anopheles gambiae transposase protein. Length = 603 Score = 49.6 bits (113), Expect = 9e-08 Identities = 25/67 (37%), Positives = 41/67 (61%) Frame = -1 Query: 454 DKINLSSDYSLWSDHHKLVQRNWLYNAAFKYLTMVAGSVPSERLFTKIAQVLTQQRSRLQ 275 + I+L +D LW H+++ + LY A L + SVP ERLF+K Q+ +++RSRL Sbjct: 531 ENIDLENDPLLWWKEHQVLYPS-LYTLAMSTLCIPGTSVPCERLFSKAGQIYSEKRSRLA 589 Query: 274 AKRVNKI 254 K++ +I Sbjct: 590 PKKLQEI 596 >AB090822-2|BAC57920.1| 1173|Anopheles gambiae reverse transcriptase protein. Length = 1173 Score = 23.4 bits (48), Expect = 6.7 Identities = 14/58 (24%), Positives = 31/58 (53%), Gaps = 2/58 (3%) Frame = -1 Query: 487 CTTTESVLHNSDKINLSSDYSLWSD--HHKLVQRNWLYNAAFKYLTMVAGSVPSERLF 320 C+T+++++ + K +D L S+ H NW +++ + + AGS P +R++ Sbjct: 12 CSTSQNLMLQAAK-EQHADVILVSELYRHPPNNGNWAVDSSGRVAVVAAGSRPIQRMW 68 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 681,550 Number of Sequences: 2352 Number of extensions: 13826 Number of successful extensions: 12 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 68159265 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -