BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0254 (679 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AL731544-3|CAI14998.1| 431|Homo sapiens novel SH2 domain-contai... 30 6.6 AL731544-2|CAI14997.1| 357|Homo sapiens novel SH2 domain-contai... 30 6.6 AL731544-1|CAI14996.1| 215|Homo sapiens novel SH2 domain-contai... 30 6.6 AK123978-1|BAC85741.1| 309|Homo sapiens protein ( Homo sapiens ... 30 6.6 AK123885-1|BAC85715.1| 357|Homo sapiens protein ( Homo sapiens ... 30 6.6 >AL731544-3|CAI14998.1| 431|Homo sapiens novel SH2 domain-containing protein protein. Length = 431 Score = 30.3 bits (65), Expect = 6.6 Identities = 13/41 (31%), Positives = 24/41 (58%) Frame = -1 Query: 388 WLYNAAFKYLTMVAGSVPSERLFTKIAQVLTQQRSRLQAKR 266 WL A + + G P ++ + +I++ L +R+RLQA+R Sbjct: 69 WLLGADGEVWVWIMGEGPGDKPYEEISEELIAERARLQAQR 109 >AL731544-2|CAI14997.1| 357|Homo sapiens novel SH2 domain-containing protein protein. Length = 357 Score = 30.3 bits (65), Expect = 6.6 Identities = 13/41 (31%), Positives = 24/41 (58%) Frame = -1 Query: 388 WLYNAAFKYLTMVAGSVPSERLFTKIAQVLTQQRSRLQAKR 266 WL A + + G P ++ + +I++ L +R+RLQA+R Sbjct: 70 WLLGADGEVWVWIMGEGPGDKPYEEISEELIAERARLQAQR 110 >AL731544-1|CAI14996.1| 215|Homo sapiens novel SH2 domain-containing protein protein. Length = 215 Score = 30.3 bits (65), Expect = 6.6 Identities = 13/41 (31%), Positives = 24/41 (58%) Frame = -1 Query: 388 WLYNAAFKYLTMVAGSVPSERLFTKIAQVLTQQRSRLQAKR 266 WL A + + G P ++ + +I++ L +R+RLQA+R Sbjct: 69 WLLGADGEVWVWIMGEGPGDKPYEEISEELIAERARLQAQR 109 >AK123978-1|BAC85741.1| 309|Homo sapiens protein ( Homo sapiens cDNA FLJ41984 fis, clone SPLEN2011422, weakly similar to CALDESMON. ). Length = 309 Score = 30.3 bits (65), Expect = 6.6 Identities = 13/41 (31%), Positives = 24/41 (58%) Frame = -1 Query: 388 WLYNAAFKYLTMVAGSVPSERLFTKIAQVLTQQRSRLQAKR 266 WL A + + G P ++ + +I++ L +R+RLQA+R Sbjct: 21 WLLGADGEVWVWIMGEGPGDKPYEEISEELIAERARLQAQR 61 >AK123885-1|BAC85715.1| 357|Homo sapiens protein ( Homo sapiens cDNA FLJ41891 fis, clone OCBBF2025028. ). Length = 357 Score = 30.3 bits (65), Expect = 6.6 Identities = 13/41 (31%), Positives = 24/41 (58%) Frame = -1 Query: 388 WLYNAAFKYLTMVAGSVPSERLFTKIAQVLTQQRSRLQAKR 266 WL A + + G P ++ + +I++ L +R+RLQA+R Sbjct: 70 WLLGADGEVWVWIMGEGPGDKPYEEISEELIAERARLQAQR 110 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 89,473,911 Number of Sequences: 237096 Number of extensions: 1677842 Number of successful extensions: 2192 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2162 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2192 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 7671262118 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -