BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0252 (591 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC15A10.11 |ubr11||N-end-recognizing protein |Schizosaccharomy... 27 2.7 SPAC1F3.06c |spo15||sporulation protein Spo15|Schizosaccharomyce... 27 2.7 SPCC23B6.03c |tel1||ATM checkpoint kinase|Schizosaccharomyces po... 26 3.6 SPAC17H9.10c |ddb1||damaged DNA binding protein Ddb1 |Schizosacc... 26 3.6 SPAC222.09 |seb1||RNA-binding protein Seb1 |Schizosaccharomyces ... 26 4.7 SPAC1A6.10 ||SPAC30D11.15c|Moeb/ThiF domain|Schizosaccharomyces ... 25 6.2 SPCC1235.08c |pdh1||DUF1751 family protein|Schizosaccharomyces p... 25 8.3 >SPAC15A10.11 |ubr11||N-end-recognizing protein |Schizosaccharomyces pombe|chr 1|||Manual Length = 2052 Score = 26.6 bits (56), Expect = 2.7 Identities = 15/40 (37%), Positives = 20/40 (50%) Frame = +3 Query: 147 VLLSRIAWNLWVYGGTSVLSVFYTAWSLGNALRNYSDDSL 266 VLL++I NLW+ G S+L L N +Y D L Sbjct: 903 VLLAQIDCNLWIRNGRSILLTDAFYRQLNNIEVSYDKDIL 942 >SPAC1F3.06c |spo15||sporulation protein Spo15|Schizosaccharomyces pombe|chr 1|||Manual Length = 1957 Score = 26.6 bits (56), Expect = 2.7 Identities = 15/45 (33%), Positives = 22/45 (48%) Frame = +3 Query: 15 KDLRFIRRRSDLAWSTALTSGPGLPNTSYFHLTPYRNGLFGWSIV 149 +++R +RR SDL+ L S G +S LTP W +V Sbjct: 70 QEVRGMRRHSDLSIDAKLGSSEGSTASSALPLTPRSPSNASWLLV 114 >SPCC23B6.03c |tel1||ATM checkpoint kinase|Schizosaccharomyces pombe|chr 3|||Manual Length = 2812 Score = 26.2 bits (55), Expect = 3.6 Identities = 9/28 (32%), Positives = 18/28 (64%) Frame = +1 Query: 508 LHERRGPLTIRWAGCSSVYQGNKKKKKK 591 +HE+R PL I + +++Y+ N+ + K Sbjct: 1836 VHEKRSPLAISYLDAANMYRSNEDEGTK 1863 >SPAC17H9.10c |ddb1||damaged DNA binding protein Ddb1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 1072 Score = 26.2 bits (55), Expect = 3.6 Identities = 18/45 (40%), Positives = 23/45 (51%), Gaps = 2/45 (4%) Frame = -1 Query: 144 STIRTARFCMESNGSSW-YLGAPAQR*EQYS-TRGRTCAL*SASL 16 S+IR A FC N SSW + A E YS R C + SA++ Sbjct: 11 SSIRNAVFCKFVNASSWNVIVAKVNCLEVYSYENNRLCLITSANI 55 >SPAC222.09 |seb1||RNA-binding protein Seb1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 620 Score = 25.8 bits (54), Expect = 4.7 Identities = 9/13 (69%), Positives = 11/13 (84%) Frame = -2 Query: 248 IPQSIPQGPCGIK 210 +PQSIP GP G+K Sbjct: 265 VPQSIPSGPMGMK 277 >SPAC1A6.10 ||SPAC30D11.15c|Moeb/ThiF domain|Schizosaccharomyces pombe|chr 1|||Manual Length = 485 Score = 25.4 bits (53), Expect = 6.2 Identities = 8/30 (26%), Positives = 20/30 (66%) Frame = -1 Query: 507 SAMPGAEPSRLPTIKYSPQAWFEEAHVIAL 418 SA+P E ++ ++++PQ F+ +++A+ Sbjct: 411 SALPPHESQKVTVVRWNPQLPFDHTNLVAM 440 >SPCC1235.08c |pdh1||DUF1751 family protein|Schizosaccharomyces pombe|chr 3|||Manual Length = 226 Score = 25.0 bits (52), Expect = 8.3 Identities = 13/38 (34%), Positives = 21/38 (55%), Gaps = 1/38 (2%) Frame = +3 Query: 102 FHLTPYRNGLFGWSIVLLSRIAWNLW-VYGGTSVLSVF 212 FHL P LF W+I+ S + N++ + +LSV+ Sbjct: 47 FHLVPNALFLFPWTIITTSFVDANVFTLLSSILILSVY 84 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,662,912 Number of Sequences: 5004 Number of extensions: 56839 Number of successful extensions: 162 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 156 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 161 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 256184654 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -