BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0251 (639 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. 28 0.057 L01617-1|AAA30097.1| 46|Tribolium castaneum zinc finger protei... 25 0.53 AY887136-1|AAW78361.1| 580|Tribolium castaneum vasa RNA helicas... 24 1.2 EU019709-1|ABU25221.1| 540|Tribolium castaneum aspartate 1-deca... 23 1.6 AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 23 2.8 >DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. Length = 822 Score = 28.3 bits (60), Expect = 0.057 Identities = 17/45 (37%), Positives = 23/45 (51%), Gaps = 2/45 (4%) Frame = -3 Query: 388 ESTPYGSVDRSSPPSLPSNRCGSRNRS--TTSLAPPLYTGSASKR 260 ES Y S++ ++PP P R S + T S PPLY +KR Sbjct: 719 ESISYLSMENNAPPPPPPPRVESFAETVRTVSKIPPLYKDLVAKR 763 >L01617-1|AAA30097.1| 46|Tribolium castaneum zinc finger protein protein. Length = 46 Score = 25.0 bits (52), Expect = 0.53 Identities = 8/11 (72%), Positives = 9/11 (81%) Frame = -3 Query: 622 CPKAFFQPWFL 590 CPKAF +PW L Sbjct: 13 CPKAFSRPWLL 23 >AY887136-1|AAW78361.1| 580|Tribolium castaneum vasa RNA helicase protein. Length = 580 Score = 23.8 bits (49), Expect = 1.2 Identities = 17/50 (34%), Positives = 23/50 (46%) Frame = +3 Query: 447 LLHTVGDSRVHGGTTRTIRCCVQVLTDVHVALHDGVICGLVDAASFIPKN 596 L T +HGGTT TI Q + + GVI G+ A F+ +N Sbjct: 41 LSETTAPRSIHGGTTVTI-TATQTGESEMMVVTSGVIPGV--AVDFLGEN 87 >EU019709-1|ABU25221.1| 540|Tribolium castaneum aspartate 1-decarboxylase protein. Length = 540 Score = 23.4 bits (48), Expect = 1.6 Identities = 7/17 (41%), Positives = 13/17 (76%) Frame = +3 Query: 363 STDPYGVLSLWRSNDLN 413 + DPYG+++ W ++ LN Sbjct: 141 AVDPYGLVAQWATDALN 157 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 22.6 bits (46), Expect = 2.8 Identities = 9/25 (36%), Positives = 15/25 (60%) Frame = -3 Query: 343 LPSNRCGSRNRSTTSLAPPLYTGSA 269 LP++RC SR S + + P +G + Sbjct: 79 LPNSRCNSRESSDSLVQPRCPSGES 103 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 157,793 Number of Sequences: 336 Number of extensions: 3557 Number of successful extensions: 7 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 16501678 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -