BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0249 (510 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC338.14 |||adenosine kinase |Schizosaccharomyces pombe|chr 3|... 26 3.8 SPAC3F10.04 |gsa1|gsh2|glutathione synthetase large subunit Gsa1... 25 5.0 SPAC1D4.14 |tho2|SPAC22F3.14c|THO complex subunit Tho2 |Schizosa... 25 8.7 >SPCC338.14 |||adenosine kinase |Schizosaccharomyces pombe|chr 3|||Manual Length = 340 Score = 25.8 bits (54), Expect = 3.8 Identities = 18/52 (34%), Positives = 26/52 (50%), Gaps = 3/52 (5%) Frame = +2 Query: 5 TVDILTLKGITLNMITYAFNKKNEIMLCT---VKNNYKFLLMKFQLVWKFIQ 151 +VD T G+ + + N KN LCT NNYK ++ VWKF++ Sbjct: 104 SVDPTTPTGVCA--VVLSNNNKNR-SLCTNLGAANNYKLKDLQQPNVWKFVE 152 >SPAC3F10.04 |gsa1|gsh2|glutathione synthetase large subunit Gsa1|Schizosaccharomyces pombe|chr 1|||Manual Length = 498 Score = 25.4 bits (53), Expect = 5.0 Identities = 12/37 (32%), Positives = 21/37 (56%) Frame = +2 Query: 56 AFNKKNEIMLCTVKNNYKFLLMKFQLVWKFIQLFNKL 166 A+NK + + N+Y+FL + Q + K+ + NKL Sbjct: 68 AYNK----LYAKIANDYEFLRLHLQSITKYDEFMNKL 100 >SPAC1D4.14 |tho2|SPAC22F3.14c|THO complex subunit Tho2 |Schizosaccharomyces pombe|chr 1|||Manual Length = 1628 Score = 24.6 bits (51), Expect = 8.7 Identities = 10/27 (37%), Positives = 15/27 (55%) Frame = -3 Query: 505 FLFKWNESQNLFYLNFAIPYKRFKLFF 425 F W++ QN L+ +PY +F L F Sbjct: 1179 FRLYWSDEQNDPDLSAVLPYNKFVLLF 1205 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,887,815 Number of Sequences: 5004 Number of extensions: 33751 Number of successful extensions: 64 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 61 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 64 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 204242806 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -