BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0247 (696 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC27E2.09 |mak2|phk1|histidine kinase Mak2 |Schizosaccharomyce... 27 1.9 SPAC1782.01 ||SPAPYUG7.07|proteasome component|Schizosaccharomyc... 27 3.4 SPAC20H4.10 |ufd2||ubiquitin-protein ligase E4 |Schizosaccharomy... 25 7.8 >SPAC27E2.09 |mak2|phk1|histidine kinase Mak2 |Schizosaccharomyces pombe|chr 1|||Manual Length = 2310 Score = 27.5 bits (58), Expect = 1.9 Identities = 11/37 (29%), Positives = 19/37 (51%) Frame = -2 Query: 239 RHNYFSAPRRAPVTYTTVKGPMQFFSCIICEVFLTSK 129 R NYF +R P + + G + F C++ + TS+ Sbjct: 486 RENYFKLKKRDPQQFRSASGRLGFMVCLLEILSFTSR 522 >SPAC1782.01 ||SPAPYUG7.07|proteasome component|Schizosaccharomyces pombe|chr 1|||Manual Length = 1679 Score = 26.6 bits (56), Expect = 3.4 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = +2 Query: 494 CQTVIFETRIKSSNFFDRETIITPI*KYLTYLA 592 C T+I + K+ NFF ET + I ++YLA Sbjct: 649 CFTIISTSNNKNDNFFKAETALLIIGYTISYLA 681 >SPAC20H4.10 |ufd2||ubiquitin-protein ligase E4 |Schizosaccharomyces pombe|chr 1|||Manual Length = 1010 Score = 25.4 bits (53), Expect = 7.8 Identities = 12/25 (48%), Positives = 16/25 (64%), Gaps = 1/25 (4%) Frame = -1 Query: 186 QRANAIFLMHNMRSFFDFE-IMNFV 115 +RA +I HN++S FD E I FV Sbjct: 887 ERATSIMTKHNLKSSFDIEAIKEFV 911 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,566,544 Number of Sequences: 5004 Number of extensions: 51529 Number of successful extensions: 113 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 109 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 113 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 321151040 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -