BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0246 (595 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY334011-1|AAR01136.1| 188|Anopheles gambiae beta-tubulin protein. 56 7e-10 AY334010-1|AAR01135.1| 188|Anopheles gambiae beta-tubulin protein. 56 7e-10 AY334009-1|AAR01134.1| 188|Anopheles gambiae beta-tubulin protein. 56 7e-10 AY334008-1|AAR01133.1| 188|Anopheles gambiae beta-tubulin protein. 56 7e-10 U50468-1|AAA93472.1| 91|Anopheles gambiae protein ( Anopheles ... 50 4e-08 AB090824-2|BAC57924.1| 1248|Anopheles gambiae reverse transcript... 28 0.020 AY390608-1|AAR27305.1| 242|Anopheles gambiae SP22D protein. 27 0.46 AY390607-1|AAR27304.1| 242|Anopheles gambiae SP22D protein. 27 0.46 AY390606-1|AAR27303.1| 241|Anopheles gambiae SP22D protein. 27 0.46 AY390605-1|AAR27302.1| 241|Anopheles gambiae SP22D protein. 27 0.46 AY390604-1|AAR27301.1| 241|Anopheles gambiae SP22D protein. 27 0.46 AY390603-1|AAR27300.1| 241|Anopheles gambiae SP22D protein. 27 0.46 AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine pr... 27 0.46 AF117751-1|AAD38337.3| 1322|Anopheles gambiae serine protease 22... 27 0.46 AF444783-1|AAL37904.1| 1356|Anopheles gambiae Trex protein. 26 0.80 Z69981-1|CAA93821.1| 327|Anopheles gambiae maltase precursor pr... 25 2.4 CR954257-8|CAJ14159.1| 562|Anopheles gambiae putative esterase ... 23 5.6 AY028784-1|AAK32958.2| 499|Anopheles gambiae cytochrome P450 pr... 23 7.4 AJ496389-1|CAD43035.1| 103|Anopheles gambiae mannosyl glycoprot... 23 9.8 AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical prote... 23 9.8 >AY334011-1|AAR01136.1| 188|Anopheles gambiae beta-tubulin protein. Length = 188 Score = 56.4 bits (130), Expect = 7e-10 Identities = 25/42 (59%), Positives = 29/42 (69%) Frame = +1 Query: 388 HYTIGKEIVDLVLDRIRKLADQCTGLQGFLIFHSFGGGTGLG 513 HYT G E+VD VLD +RK + C LQGF + HS GGGTG G Sbjct: 1 HYTEGAELVDAVLDVVRKECENCDCLQGFQLTHSLGGGTGSG 42 >AY334010-1|AAR01135.1| 188|Anopheles gambiae beta-tubulin protein. Length = 188 Score = 56.4 bits (130), Expect = 7e-10 Identities = 25/42 (59%), Positives = 29/42 (69%) Frame = +1 Query: 388 HYTIGKEIVDLVLDRIRKLADQCTGLQGFLIFHSFGGGTGLG 513 HYT G E+VD VLD +RK + C LQGF + HS GGGTG G Sbjct: 1 HYTEGAELVDAVLDVVRKECENCDCLQGFQLTHSLGGGTGSG 42 >AY334009-1|AAR01134.1| 188|Anopheles gambiae beta-tubulin protein. Length = 188 Score = 56.4 bits (130), Expect = 7e-10 Identities = 25/42 (59%), Positives = 29/42 (69%) Frame = +1 Query: 388 HYTIGKEIVDLVLDRIRKLADQCTGLQGFLIFHSFGGGTGLG 513 HYT G E+VD VLD +RK + C LQGF + HS GGGTG G Sbjct: 1 HYTEGAELVDAVLDVVRKECENCDCLQGFQLTHSLGGGTGSG 42 >AY334008-1|AAR01133.1| 188|Anopheles gambiae beta-tubulin protein. Length = 188 Score = 56.4 bits (130), Expect = 7e-10 Identities = 25/42 (59%), Positives = 29/42 (69%) Frame = +1 Query: 388 HYTIGKEIVDLVLDRIRKLADQCTGLQGFLIFHSFGGGTGLG 513 HYT G E+VD VLD +RK + C LQGF + HS GGGTG G Sbjct: 1 HYTEGAELVDAVLDVVRKECENCDCLQGFQLTHSLGGGTGSG 42 >U50468-1|AAA93472.1| 91|Anopheles gambiae protein ( Anopheles gambiae putativetubulin alpha chain mRNA, complete cds. ). Length = 91 Score = 50.4 bits (115), Expect = 4e-08 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = +2 Query: 71 MRECISVHVGQAGVQIGNACWE 136 MRECISVHVGQAGVQIGN CW+ Sbjct: 1 MRECISVHVGQAGVQIGNPCWD 22 Score = 38.3 bits (85), Expect = 2e-04 Identities = 21/45 (46%), Positives = 23/45 (51%) Frame = +3 Query: 126 PAGSFTAWSTASSLMARCPQTRPSGVETILSTLSSARPELASTTP 260 P T WS AS+ RCP+TR S ST SS R AST P Sbjct: 19 PCWDCTVWSMASNRTVRCPRTRRSEAVMTRSTPSSPRLAQASTCP 63 >AB090824-2|BAC57924.1| 1248|Anopheles gambiae reverse transcriptase protein. Length = 1248 Score = 28.3 bits (60), Expect(2) = 0.020 Identities = 11/32 (34%), Positives = 18/32 (56%) Frame = +3 Query: 177 CPQTRPSGVETILSTLSSARPELASTTPCCLR 272 C RPS ++ ++ S RP+LA+ + C R Sbjct: 164 CGSARPSRIDVAFASPSICRPDLAANSATCWR 195 Score = 21.8 bits (44), Expect(2) = 0.020 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = +3 Query: 120 VMPAGSFTAWSTASSLMARCPQTRPSGV 203 V+ AG F AW TA +T+P G+ Sbjct: 116 VLLAGDFNAWHTAWG----SERTKPKGI 139 >AY390608-1|AAR27305.1| 242|Anopheles gambiae SP22D protein. Length = 242 Score = 27.1 bits (57), Expect = 0.46 Identities = 16/44 (36%), Positives = 22/44 (50%) Frame = -2 Query: 315 CASADLINNSRFKIDEDSTGSCLPAPVSLKKVLKESSPPPMVLS 184 CA L N + + D S SCLP P SL V + ++ P L+ Sbjct: 142 CAPGTLFNPNTRECDHPSKVSCLPVP-SLNSVNEPANRAPPKLA 184 >AY390607-1|AAR27304.1| 242|Anopheles gambiae SP22D protein. Length = 242 Score = 27.1 bits (57), Expect = 0.46 Identities = 16/44 (36%), Positives = 22/44 (50%) Frame = -2 Query: 315 CASADLINNSRFKIDEDSTGSCLPAPVSLKKVLKESSPPPMVLS 184 CA L N + + D S SCLP P SL V + ++ P L+ Sbjct: 142 CAPGTLFNPNTRECDHPSKVSCLPVP-SLNSVNEPANRAPPKLA 184 >AY390606-1|AAR27303.1| 241|Anopheles gambiae SP22D protein. Length = 241 Score = 27.1 bits (57), Expect = 0.46 Identities = 16/44 (36%), Positives = 22/44 (50%) Frame = -2 Query: 315 CASADLINNSRFKIDEDSTGSCLPAPVSLKKVLKESSPPPMVLS 184 CA L N + + D S SCLP P SL V + ++ P L+ Sbjct: 141 CAPGTLFNPNTRECDHPSKVSCLPVP-SLNSVNEPANRAPPKLA 183 >AY390605-1|AAR27302.1| 241|Anopheles gambiae SP22D protein. Length = 241 Score = 27.1 bits (57), Expect = 0.46 Identities = 16/44 (36%), Positives = 22/44 (50%) Frame = -2 Query: 315 CASADLINNSRFKIDEDSTGSCLPAPVSLKKVLKESSPPPMVLS 184 CA L N + + D S SCLP P SL V + ++ P L+ Sbjct: 141 CAPGTLFNPNTRECDHPSKVSCLPVP-SLNSVNEPANRAPPKLA 183 >AY390604-1|AAR27301.1| 241|Anopheles gambiae SP22D protein. Length = 241 Score = 27.1 bits (57), Expect = 0.46 Identities = 16/44 (36%), Positives = 22/44 (50%) Frame = -2 Query: 315 CASADLINNSRFKIDEDSTGSCLPAPVSLKKVLKESSPPPMVLS 184 CA L N + + D S SCLP P SL V + ++ P L+ Sbjct: 141 CAPGTLFNPNTRECDHPSKVSCLPVP-SLNSVNEPANRAPPKLA 183 >AY390603-1|AAR27300.1| 241|Anopheles gambiae SP22D protein. Length = 241 Score = 27.1 bits (57), Expect = 0.46 Identities = 16/44 (36%), Positives = 22/44 (50%) Frame = -2 Query: 315 CASADLINNSRFKIDEDSTGSCLPAPVSLKKVLKESSPPPMVLS 184 CA L N + + D S SCLP P SL V + ++ P L+ Sbjct: 141 CAPGTLFNPNTRECDHPSKVSCLPVP-SLNSVNEPANRAPPKLA 183 >AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine protease protein. Length = 1322 Score = 27.1 bits (57), Expect = 0.46 Identities = 16/44 (36%), Positives = 22/44 (50%) Frame = -2 Query: 315 CASADLINNSRFKIDEDSTGSCLPAPVSLKKVLKESSPPPMVLS 184 CA L N + + D S SCLP P SL V + ++ P L+ Sbjct: 213 CAPGTLFNPNTRECDHPSKVSCLPVP-SLNSVNEPANRAPPKLA 255 >AF117751-1|AAD38337.3| 1322|Anopheles gambiae serine protease 22D protein. Length = 1322 Score = 27.1 bits (57), Expect = 0.46 Identities = 16/44 (36%), Positives = 22/44 (50%) Frame = -2 Query: 315 CASADLINNSRFKIDEDSTGSCLPAPVSLKKVLKESSPPPMVLS 184 CA L N + + D S SCLP P SL V + ++ P L+ Sbjct: 212 CAPGTLFNPNTRECDHPSKVSCLPVP-SLNSVNEPANRAPPKLA 254 >AF444783-1|AAL37904.1| 1356|Anopheles gambiae Trex protein. Length = 1356 Score = 26.2 bits (55), Expect = 0.80 Identities = 13/34 (38%), Positives = 20/34 (58%), Gaps = 2/34 (5%) Frame = -1 Query: 535 RSINKEVNPSR--YLPRRSGRSGILADRYTGQRA 440 RS ++ N +R +LPR R+G+ DR T +A Sbjct: 338 RSFKQQNNEARAHHLPRSDQRAGVALDRKTSSKA 371 >Z69981-1|CAA93821.1| 327|Anopheles gambiae maltase precursor protein. Length = 327 Score = 24.6 bits (51), Expect = 2.4 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = +2 Query: 455 VPVCKDS*SSTPSGEVPAWV 514 V V KD S P+G+VP WV Sbjct: 65 VKVVKDWMSILPAGQVPNWV 84 >CR954257-8|CAJ14159.1| 562|Anopheles gambiae putative esterase protein. Length = 562 Score = 23.4 bits (48), Expect = 5.6 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = +1 Query: 475 LIFHSFGGGTGLGSLPY*WSVSSLT 549 L+ S+ G +PY WSV+ LT Sbjct: 446 LMLGSWPGAMHADDIPYLWSVTDLT 470 >AY028784-1|AAK32958.2| 499|Anopheles gambiae cytochrome P450 protein. Length = 499 Score = 23.0 bits (47), Expect = 7.4 Identities = 9/19 (47%), Positives = 10/19 (52%) Frame = +1 Query: 199 GWRRFFQHFLQRDRSWQAR 255 GW + HF QR R W R Sbjct: 12 GWLWIYLHFNQRYRFWVER 30 >AJ496389-1|CAD43035.1| 103|Anopheles gambiae mannosyl glycoprotein transferase protein. Length = 103 Score = 22.6 bits (46), Expect = 9.8 Identities = 8/30 (26%), Positives = 15/30 (50%) Frame = +3 Query: 312 HIQTVVSSRTTYYW*GRCGQQLCPWSLHHW 401 H + +RT +Y RC + C + ++W Sbjct: 66 HNMGMAFNRTMWYEIVRCARHFCEYDDYNW 95 >AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical protein protein. Length = 1645 Score = 22.6 bits (46), Expect = 9.8 Identities = 11/33 (33%), Positives = 17/33 (51%) Frame = +1 Query: 100 PSRSPDR*CLLGALLPGARHPA*WPDAHRQDHR 198 P+ P + L+ +LP + PA P R+D R Sbjct: 1107 PAVEPAKKTLVATILPNSAKPAQQPPPLRRDAR 1139 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 668,332 Number of Sequences: 2352 Number of extensions: 14266 Number of successful extensions: 41 Number of sequences better than 10.0: 20 Number of HSP's better than 10.0 without gapping: 39 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 41 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 57188952 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -