BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0244 (784 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY994089-1|AAX86002.1| 267|Anopheles gambiae hyp37.7-like precu... 26 1.5 AF395079-1|AAK97461.1| 371|Anopheles gambiae basic helix-loop-h... 25 2.0 >AY994089-1|AAX86002.1| 267|Anopheles gambiae hyp37.7-like precursor protein. Length = 267 Score = 25.8 bits (54), Expect = 1.5 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = -1 Query: 583 IIGLNSGLSGEFSTLTYTYQNYIAY 509 + +N+GL+G LT QNYI + Sbjct: 105 VCAINAGLTGANPNLTIALQNYIGH 129 >AF395079-1|AAK97461.1| 371|Anopheles gambiae basic helix-loop-helix transcriptionfactor ASH protein. Length = 371 Score = 25.4 bits (53), Expect = 2.0 Identities = 15/60 (25%), Positives = 27/60 (45%) Frame = +2 Query: 425 SISRALFSILCKNCGTFKQ*RTNDDSENVSNIILVRVGKGRKLTAQPAIQSNNEQINKVP 604 ++S+ L +I+ NCG Q + + S+ +GK R L P + + K+P Sbjct: 9 ALSQNLHNIMPGNCGLALQQKPIGSGQLTSSSAASLLGKQRPLAPAPTVLGGHRANAKLP 68 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 778,352 Number of Sequences: 2352 Number of extensions: 15536 Number of successful extensions: 16 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 81913191 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -