BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0244 (784 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY127579-1|AAN02286.1| 405|Apis mellifera venom protease precur... 25 1.1 U26026-1|AAA69069.1| 377|Apis mellifera long-wavelength rhodops... 21 9.8 >AY127579-1|AAN02286.1| 405|Apis mellifera venom protease precursor protein. Length = 405 Score = 24.6 bits (51), Expect = 1.1 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = +2 Query: 515 NIILVRVGKGRKLTAQPAIQSNNEQINKVPCSYHQ 619 N++LV+ K L +I + Q+NK C Y+Q Sbjct: 12 NVVLVKKVKIVLLIFYGSIMFSMTQVNKEECDYYQ 46 >U26026-1|AAA69069.1| 377|Apis mellifera long-wavelength rhodopsin protein. Length = 377 Score = 21.4 bits (43), Expect = 9.8 Identities = 6/17 (35%), Positives = 13/17 (76%) Frame = +2 Query: 134 NDFVLGISLKSFLFIYC 184 N FV+ +++ +FL ++C Sbjct: 88 NLFVINLAISNFLMMFC 104 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 211,213 Number of Sequences: 438 Number of extensions: 4127 Number of successful extensions: 8 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 24639531 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -