BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0239 (733 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF125543-1|ABL73927.1| 475|Tribolium castaneum chitinase 4 prot... 23 1.9 AF317551-1|AAG39634.1| 312|Tribolium castaneum distal-less prot... 23 1.9 >EF125543-1|ABL73927.1| 475|Tribolium castaneum chitinase 4 protein. Length = 475 Score = 23.4 bits (48), Expect = 1.9 Identities = 8/30 (26%), Positives = 16/30 (53%) Frame = -1 Query: 211 SSNAFQFEGWGSRCNYTETLELISQGVWRI 122 + N+ ++ G Y E +EL +G W++ Sbjct: 284 AGNSGKYTGEAGMLGYNEIVELQKEGGWKV 313 >AF317551-1|AAG39634.1| 312|Tribolium castaneum distal-less protein. Length = 312 Score = 23.4 bits (48), Expect = 1.9 Identities = 10/34 (29%), Positives = 15/34 (44%) Frame = +1 Query: 172 NGYPTLQTETHYCFTAEIGGAVVPTRGNHKRSYP 273 +GY L+T + F + G A G H +P Sbjct: 32 HGYGPLRTSYQHHFNSPAGNAHTGPTGTHDAGFP 65 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 172,181 Number of Sequences: 336 Number of extensions: 3841 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19571740 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -