BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0239 (733 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_44767| Best HMM Match : WD40 (HMM E-Value=0.074) 105 4e-23 SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 8e-18 SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) 85 6e-17 SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) 85 6e-17 SB_4159| Best HMM Match : Vpu (HMM E-Value=2) 85 6e-17 SB_58190| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 1e-16 SB_45641| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 1e-16 SB_52731| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 2e-16 SB_16375| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 5e-16 SB_59725| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 4e-15 SB_37427| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 4e-15 SB_27498| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 4e-15 SB_26118| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 4e-15 SB_57017| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 4e-15 SB_3496| Best HMM Match : Herpes_UL49_5 (HMM E-Value=7.2) 77 1e-14 SB_37661| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_18570| Best HMM Match : Moricin (HMM E-Value=6.5) 75 5e-14 SB_46185| Best HMM Match : Flt3_lig (HMM E-Value=3.3) 75 8e-14 SB_46589| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 1e-13 SB_40004| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_28196| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_5984| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_2952| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_39849| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_20378| Best HMM Match : Adeno_E1B_19K (HMM E-Value=5.7) 73 3e-13 SB_20313| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_501| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_34678| Best HMM Match : Bromodomain (HMM E-Value=9e-25) 72 6e-13 SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) 71 7e-13 SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) 71 7e-13 SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) 71 7e-13 SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) 71 7e-13 SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_51515| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016) 71 7e-13 SB_47276| Best HMM Match : DUF851 (HMM E-Value=9.6) 71 7e-13 SB_46649| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_46412| Best HMM Match : HEAT (HMM E-Value=8) 71 7e-13 SB_46374| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_46344| Best HMM Match : ig (HMM E-Value=0.0082) 71 7e-13 SB_46308| Best HMM Match : IMS (HMM E-Value=0) 71 7e-13 SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_45291| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_44894| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_44606| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_44358| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_43671| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_43630| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_43569| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_43145| Best HMM Match : PEGSRP (HMM E-Value=7.2) 71 7e-13 SB_42831| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_42725| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_42655| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_42158| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_42069| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_41806| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_41728| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_41712| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_41481| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_40939| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_40610| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_40566| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_40462| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_39373| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_38916| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_38016| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_37690| Best HMM Match : IgG_binding_B (HMM E-Value=4.2) 71 7e-13 SB_37536| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_37412| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9) 71 7e-13 SB_36865| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_35997| Best HMM Match : Phage_fiber (HMM E-Value=0.78) 71 7e-13 SB_35689| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) 71 7e-13 SB_34829| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_34793| Best HMM Match : TIL (HMM E-Value=4.5) 71 7e-13 SB_34683| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_34501| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_34015| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_33403| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_33270| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_32674| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_32508| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_32411| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_32110| Best HMM Match : PEGSRP (HMM E-Value=9.6) 71 7e-13 SB_31658| Best HMM Match : Arm (HMM E-Value=0.91) 71 7e-13 SB_31227| Best HMM Match : RIO1 (HMM E-Value=0.13) 71 7e-13 SB_31056| Best HMM Match : Virus_P-coat (HMM E-Value=6.4) 71 7e-13 SB_30810| Best HMM Match : JmjC (HMM E-Value=0.0021) 71 7e-13 SB_30786| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_30192| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_29084| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_28922| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_28866| Best HMM Match : PhdYeFM (HMM E-Value=8.3) 71 7e-13 SB_28269| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_27927| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_27779| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_27619| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_27047| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_25936| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_24859| Best HMM Match : HAP (HMM E-Value=6.4) 71 7e-13 SB_24787| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_24544| Best HMM Match : PSCyt1 (HMM E-Value=4.3) 71 7e-13 SB_24181| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_23437| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_22658| Best HMM Match : Protamine_3 (HMM E-Value=9.6) 71 7e-13 SB_22468| Best HMM Match : CUT (HMM E-Value=6.8) 71 7e-13 SB_22254| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_21247| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_20864| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_20839| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_20747| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_19461| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_18812| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_18436| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_18289| Best HMM Match : IgG_binding_B (HMM E-Value=7) 71 7e-13 SB_17565| Best HMM Match : EGF (HMM E-Value=5.1e-05) 71 7e-13 SB_16725| Best HMM Match : DAGAT (HMM E-Value=1e-39) 71 7e-13 SB_16155| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_15873| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_15493| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_15346| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_15295| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_15150| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_15134| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_15127| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_14936| Best HMM Match : Pep_M12B_propep (HMM E-Value=9.7) 71 7e-13 SB_14862| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_14045| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_13480| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_13372| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_13236| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_12962| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_12873| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_12726| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_12236| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_12187| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_12019| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_11632| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_11249| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_10911| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_10687| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_10456| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_10031| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_9995| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_9697| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_9450| Best HMM Match : CM_1 (HMM E-Value=3.1) 71 7e-13 SB_8806| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_8714| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_8621| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_8582| Best HMM Match : CsgG (HMM E-Value=4.9e-06) 71 7e-13 SB_8530| Best HMM Match : ThiC (HMM E-Value=2.7e-07) 71 7e-13 SB_8498| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_7973| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_7142| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_6842| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_6464| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_6117| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_6070| Best HMM Match : PEGSRP (HMM E-Value=3.8) 71 7e-13 SB_5521| Best HMM Match : SWIM (HMM E-Value=6.9) 71 7e-13 SB_5457| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_4705| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_4191| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_3728| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_3676| Best HMM Match : Cuticle_2 (HMM E-Value=3.2) 71 7e-13 SB_2468| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_2230| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_1204| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_965| Best HMM Match : IgG_binding_B (HMM E-Value=8.5) 71 7e-13 SB_58797| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_55925| Best HMM Match : Homeobox (HMM E-Value=1e-26) 71 7e-13 SB_55779| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_55121| Best HMM Match : DUF971 (HMM E-Value=8.5) 71 7e-13 SB_55030| Best HMM Match : Toxin_27 (HMM E-Value=1.2) 71 7e-13 SB_54995| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_54425| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_53532| Best HMM Match : IgG_binding_B (HMM E-Value=7.8) 71 7e-13 SB_52081| Best HMM Match : DUF1634 (HMM E-Value=0.55) 71 7e-13 SB_51954| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_51949| Best HMM Match : Toxin_14 (HMM E-Value=0.051) 71 7e-13 SB_51253| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_49112| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_48731| Best HMM Match : zf-C3HC4 (HMM E-Value=6.5e-08) 71 7e-13 SB_48358| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_45537| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_45065| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_44400| Best HMM Match : AT_hook (HMM E-Value=3.3) 71 7e-13 SB_43660| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_43339| Best HMM Match : SAC3_GANP (HMM E-Value=1.8e-09) 71 7e-13 SB_42664| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_42518| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_41564| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_41244| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_40229| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_39279| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_36908| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_36598| Best HMM Match : E-MAP-115 (HMM E-Value=0.092) 71 7e-13 SB_35835| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_34602| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_32133| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_31775| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_31269| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_30891| Best HMM Match : LIM (HMM E-Value=4.40008e-43) 71 7e-13 SB_30664| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_28552| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_27244| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_27230| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_26386| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_25785| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_22440| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_20758| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_20620| Best HMM Match : zf-HIT (HMM E-Value=8.5e-10) 71 7e-13 SB_19831| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_19310| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_19077| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_15849| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_14754| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_12231| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_12047| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_11962| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_11928| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_11382| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_11225| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_9128| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_8032| Best HMM Match : IBB (HMM E-Value=0.46) 71 7e-13 SB_7769| Best HMM Match : Histone (HMM E-Value=0.2) 71 7e-13 SB_7742| Best HMM Match : HEAT (HMM E-Value=9e-23) 71 7e-13 SB_7402| Best HMM Match : Extensin_2 (HMM E-Value=2) 71 7e-13 SB_6875| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_5394| Best HMM Match : PEGSRP (HMM E-Value=1.5) 71 7e-13 SB_2918| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_1078| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_372| Best HMM Match : CBM_2 (HMM E-Value=0.00043) 71 7e-13 SB_33777| Best HMM Match : BTP (HMM E-Value=8.9) 70 2e-12 SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 70 2e-12 SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 70 2e-12 SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_57634| Best HMM Match : EGF_2 (HMM E-Value=0.0014) 70 2e-12 SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_57287| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) 70 2e-12 SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) 70 2e-12 SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) 70 2e-12 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 70 2e-12 SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1) 70 2e-12 SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3) 70 2e-12 SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) 70 2e-12 SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) 70 2e-12 SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_52260| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_52253| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_52086| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_51989| Best HMM Match : Extensin_2 (HMM E-Value=0.29) 70 2e-12 SB_51427| Best HMM Match : DUF855 (HMM E-Value=4) 70 2e-12 SB_51409| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_51320| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) 70 2e-12 SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_50493| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_50417| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_50270| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_49896| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_49839| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_49814| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_49530| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_49465| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_49395| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_49211| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_49150| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) 70 2e-12 SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_48522| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_48514| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_48486| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_48129| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_48100| Best HMM Match : Transformer (HMM E-Value=5.4) 70 2e-12 SB_48063| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_48045| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_47536| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_47480| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_47399| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_47213| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_46889| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) 70 2e-12 SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_46529| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_46517| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_46424| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) 70 2e-12 SB_46303| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_45887| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_45813| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_45524| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_45424| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_45381| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_44920| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_44806| Best HMM Match : Hist_deacetyl (HMM E-Value=0) 70 2e-12 SB_44800| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_44789| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) 70 2e-12 SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_44466| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_44411| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_44401| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_44392| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_44259| Best HMM Match : MORN (HMM E-Value=3.7) 70 2e-12 SB_44076| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_44013| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_43970| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) 70 2e-12 SB_43909| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_43701| Best HMM Match : ubiquitin (HMM E-Value=0.003) 70 2e-12 SB_43618| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_43138| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.3e-14) 70 2e-12 SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_42990| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_42937| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_42936| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) 70 2e-12 SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8) 70 2e-12 SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_42313| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_42015| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_41881| Best HMM Match : Extensin_1 (HMM E-Value=5.5) 70 2e-12 SB_41827| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_41779| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_41568| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_41365| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_41011| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_40471| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_40265| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_40240| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_40230| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_40107| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_39690| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_39438| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_39406| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_39311| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_39201| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_39107| Best HMM Match : Lyase_8 (HMM E-Value=0.016) 70 2e-12 SB_38948| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_38893| Best HMM Match : UMPH-1 (HMM E-Value=2.3e-21) 70 2e-12 SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) 70 2e-12 SB_38726| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_38504| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_38387| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_38141| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_37962| Best HMM Match : Tcp10_C (HMM E-Value=5.9e-36) 70 2e-12 SB_37635| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_37372| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_37147| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_37066| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_37038| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_37030| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_36958| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_36941| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_36853| Best HMM Match : DNA_pol_B_exo (HMM E-Value=4.2) 70 2e-12 SB_36823| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_36408| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_36358| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_35988| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 >SB_44767| Best HMM Match : WD40 (HMM E-Value=0.074) Length = 532 Score = 105 bits (252), Expect = 4e-23 Identities = 46/52 (88%), Positives = 46/52 (88%) Frame = +2 Query: 488 TGRRFTTRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTVAQPEWRM 643 TGR RDWENPGVTQLNRLAAHPPFASWRNSE PHRSPFPTVAQPEWRM Sbjct: 344 TGRHLQRRDWENPGVTQLNRLAAHPPFASWRNSER-PHRSPFPTVAQPEWRM 394 >SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 97.5 bits (232), Expect = 1e-20 Identities = 44/53 (83%), Positives = 45/53 (84%) Frame = -2 Query: 612 KGDRCGASSLLRQLAKGGCAARRLSWVTPGFSQSRVVKRRPVNCNTTHYRANW 454 +G ASSLLRQLAKGGCAARRLSWVTPGF VVKRRPVNCNTTHYRANW Sbjct: 28 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFPSHDVVKRRPVNCNTTHYRANW 80 Score = 29.1 bits (62), Expect = 3.9 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = -1 Query: 631 RLRNCWKGRSVRGLFAITPAGERGMCCKAI 542 +LRNCW+GRSVR + + G + + Sbjct: 22 QLRNCWEGRSVRASSLLRQLAKGGCAARRL 51 >SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 87.8 bits (208), Expect = 8e-18 Identities = 41/45 (91%), Positives = 42/45 (93%) Frame = +3 Query: 510 VTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEW 644 VTGKTLALPNLIALQHIPLSPAGVIA+ RTDRP QQLRSLNGEW Sbjct: 51 VTGKTLALPNLIALQHIPLSPAGVIAEEARTDRPSQQLRSLNGEW 95 Score = 41.1 bits (92), Expect = 0.001 Identities = 17/27 (62%), Positives = 19/27 (70%) Frame = +1 Query: 457 IRPIVSRITIHWPSFYNA*LGKPWRYP 537 +RP+VSRITIHW SFYN GK P Sbjct: 33 LRPVVSRITIHWTSFYNVVTGKTLALP 59 >SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) Length = 2506 Score = 85.0 bits (201), Expect = 6e-17 Identities = 41/53 (77%), Positives = 42/53 (79%) Frame = -2 Query: 612 KGDRCGASSLLRQLAKGGCAARRLSWVTPGFSQSRVVKRRPVNCNTTHYRANW 454 +G ASSLLRQLAKGGCAARRLSW GF VVKRRPVNCNTTHYRANW Sbjct: 599 EGRSVRASSLLRQLAKGGCAARRLSW---GFPSHDVVKRRPVNCNTTHYRANW 648 Score = 42.3 bits (95), Expect = 4e-04 Identities = 17/37 (45%), Positives = 22/37 (59%) Frame = -1 Query: 643 HSPFRLRNCWKGRSVRGLFAITPAGERGMCCKAIKLG 533 HSPFRLRNCW+GRSVR + + G + + G Sbjct: 589 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWG 625 >SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) Length = 281 Score = 85.0 bits (201), Expect = 6e-17 Identities = 41/53 (77%), Positives = 42/53 (79%) Frame = -2 Query: 612 KGDRCGASSLLRQLAKGGCAARRLSWVTPGFSQSRVVKRRPVNCNTTHYRANW 454 +G ASSLLRQLAKGGCAARRLSW GF VVKRRPVNCNTTHYRANW Sbjct: 42 EGRSVRASSLLRQLAKGGCAARRLSW---GFPSHDVVKRRPVNCNTTHYRANW 91 Score = 42.3 bits (95), Expect = 4e-04 Identities = 17/37 (45%), Positives = 22/37 (59%) Frame = -1 Query: 643 HSPFRLRNCWKGRSVRGLFAITPAGERGMCCKAIKLG 533 HSPFRLRNCW+GRSVR + + G + + G Sbjct: 32 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWG 68 >SB_4159| Best HMM Match : Vpu (HMM E-Value=2) Length = 779 Score = 85.0 bits (201), Expect = 6e-17 Identities = 41/53 (77%), Positives = 42/53 (79%) Frame = -2 Query: 612 KGDRCGASSLLRQLAKGGCAARRLSWVTPGFSQSRVVKRRPVNCNTTHYRANW 454 +G ASSLLRQLAKGGCAARRLSW GF VVKRRPVNCNTTHYRANW Sbjct: 42 EGRSVRASSLLRQLAKGGCAARRLSW---GFPSHDVVKRRPVNCNTTHYRANW 91 Score = 42.3 bits (95), Expect = 4e-04 Identities = 17/37 (45%), Positives = 22/37 (59%) Frame = -1 Query: 643 HSPFRLRNCWKGRSVRGLFAITPAGERGMCCKAIKLG 533 HSPFRLRNCW+GRSVR + + G + + G Sbjct: 32 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWG 68 >SB_58190| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 83.8 bits (198), Expect = 1e-16 Identities = 39/54 (72%), Positives = 41/54 (75%), Gaps = 2/54 (3%) Frame = +2 Query: 488 TGRRFTTRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 TGRRFT RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 40 TGRRFTRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 93 Score = 38.7 bits (86), Expect = 0.005 Identities = 15/23 (65%), Positives = 20/23 (86%) Frame = +3 Query: 585 AKRPRTDRPFQQLRSLNGEWQIV 653 ++ RTDRP QQLRSLNGEW+++ Sbjct: 72 SEEARTDRPSQQLRSLNGEWRLM 94 >SB_45641| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 83.8 bits (198), Expect = 1e-16 Identities = 39/45 (86%), Positives = 41/45 (91%) Frame = +3 Query: 510 VTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEW 644 VTGKTLALPNLIALQHIPLSPAGV ++ RTDRP QQLRSLNGEW Sbjct: 15 VTGKTLALPNLIALQHIPLSPAGVNSEEARTDRPSQQLRSLNGEW 59 Score = 35.9 bits (79), Expect = 0.034 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +1 Query: 472 SRITIHWPSFYNA*LGKPWRYP 537 SRITIHWPSFYN GK P Sbjct: 2 SRITIHWPSFYNVVTGKTLALP 23 >SB_52731| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 79 Score = 83.4 bits (197), Expect = 2e-16 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = -1 Query: 643 HSPFRLRNCWKGRSVRGLFAITPAGERGMCCKAIKL 536 HSPFRLRNCW+GRSVRGLFAITPAGERGMCCKAIKL Sbjct: 43 HSPFRLRNCWEGRSVRGLFAITPAGERGMCCKAIKL 78 >SB_16375| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 82.6 bits (195), Expect = 3e-16 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +3 Query: 510 VTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 VTGKTLALPNLIALQHIPLSPAG ++ RTDRP QQLRSLNGEW+++ Sbjct: 13 VTGKTLALPNLIALQHIPLSPAGRNSEEARTDRPSQQLRSLNGEWRLM 60 >SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 81.8 bits (193), Expect = 5e-16 Identities = 38/45 (84%), Positives = 40/45 (88%) Frame = +3 Query: 510 VTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEW 644 VTGKTLALPNLIALQHIPLSPAG+ + RTDRP QQLRSLNGEW Sbjct: 93 VTGKTLALPNLIALQHIPLSPAGLHREEARTDRPSQQLRSLNGEW 137 Score = 38.7 bits (86), Expect = 0.005 Identities = 16/25 (64%), Positives = 17/25 (68%) Frame = +1 Query: 463 PIVSRITIHWPSFYNA*LGKPWRYP 537 P +SRITIHWPSFYN GK P Sbjct: 77 PYMSRITIHWPSFYNVVTGKTLALP 101 >SB_59725| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 79.0 bits (186), Expect = 4e-15 Identities = 37/54 (68%), Positives = 39/54 (72%), Gaps = 2/54 (3%) Frame = +2 Query: 488 TGRRFTTRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 TGRR RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 15 TGRRLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 68 Score = 38.7 bits (86), Expect = 0.005 Identities = 15/23 (65%), Positives = 20/23 (86%) Frame = +3 Query: 585 AKRPRTDRPFQQLRSLNGEWQIV 653 ++ RTDRP QQLRSLNGEW+++ Sbjct: 47 SEEARTDRPSQQLRSLNGEWRLM 69 >SB_37427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 79.0 bits (186), Expect = 4e-15 Identities = 37/54 (68%), Positives = 39/54 (72%), Gaps = 2/54 (3%) Frame = +2 Query: 488 TGRRFTTRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 TGRR RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 35 TGRRLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 88 Score = 38.7 bits (86), Expect = 0.005 Identities = 15/23 (65%), Positives = 20/23 (86%) Frame = +3 Query: 585 AKRPRTDRPFQQLRSLNGEWQIV 653 ++ RTDRP QQLRSLNGEW+++ Sbjct: 67 SEEARTDRPSQQLRSLNGEWRLM 89 >SB_27498| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 79.0 bits (186), Expect = 4e-15 Identities = 37/54 (68%), Positives = 39/54 (72%), Gaps = 2/54 (3%) Frame = +2 Query: 488 TGRRFTTRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 TGRR RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 25 TGRRLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 78 Score = 38.7 bits (86), Expect = 0.005 Identities = 15/23 (65%), Positives = 20/23 (86%) Frame = +3 Query: 585 AKRPRTDRPFQQLRSLNGEWQIV 653 ++ RTDRP QQLRSLNGEW+++ Sbjct: 57 SEEARTDRPSQQLRSLNGEWRLM 79 >SB_26118| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 79.0 bits (186), Expect = 4e-15 Identities = 37/54 (68%), Positives = 39/54 (72%), Gaps = 2/54 (3%) Frame = +2 Query: 488 TGRRFTTRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 TGRR RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 45 TGRRLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 98 Score = 38.7 bits (86), Expect = 0.005 Identities = 15/23 (65%), Positives = 20/23 (86%) Frame = +3 Query: 585 AKRPRTDRPFQQLRSLNGEWQIV 653 ++ RTDRP QQLRSLNGEW+++ Sbjct: 77 SEEARTDRPSQQLRSLNGEWRLM 99 >SB_57017| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 79.0 bits (186), Expect = 4e-15 Identities = 37/54 (68%), Positives = 39/54 (72%), Gaps = 2/54 (3%) Frame = +2 Query: 488 TGRRFTTRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 TGRR RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 72 TGRRLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 125 Score = 38.7 bits (86), Expect = 0.005 Identities = 15/23 (65%), Positives = 20/23 (86%) Frame = +3 Query: 585 AKRPRTDRPFQQLRSLNGEWQIV 653 ++ RTDRP QQLRSLNGEW+++ Sbjct: 104 SEEARTDRPSQQLRSLNGEWRLM 126 >SB_3496| Best HMM Match : Herpes_UL49_5 (HMM E-Value=7.2) Length = 98 Score = 77.4 bits (182), Expect = 1e-14 Identities = 38/45 (84%), Positives = 39/45 (86%) Frame = +3 Query: 510 VTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEW 644 VTGKTLALPNLIALQHIPLSPAGVIAKRP +QLRSLNGEW Sbjct: 15 VTGKTLALPNLIALQHIPLSPAGVIAKRPAPIALPKQLRSLNGEW 59 Score = 41.1 bits (92), Expect = 0.001 Identities = 22/47 (46%), Positives = 23/47 (48%) Frame = +1 Query: 472 SRITIHWPSFYNA*LGKPWRYPT*SPCSTSPFRQLA**RRGPAPIAL 612 SRITIHWPSFYN GK P P + PAPIAL Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALQHIPLSPAGVIAKRPAPIAL 48 >SB_37661| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 397 Score = 75.8 bits (178), Expect = 3e-14 Identities = 37/56 (66%), Positives = 39/56 (69%), Gaps = 3/56 (5%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRMANC-KPLIF 667 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ C K IF Sbjct: 177 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRCDKSFIF 232 >SB_18570| Best HMM Match : Moricin (HMM E-Value=6.5) Length = 107 Score = 75.4 bits (177), Expect = 5e-14 Identities = 36/42 (85%), Positives = 38/42 (90%), Gaps = 1/42 (2%) Frame = -1 Query: 610 GRSV-RGLFAITPAGERGMCCKAIKLGNARVFPVTRCKTTAS 488 GR++ GLFAITPAGERGMCCKAIKLGNARVFPVT KTTAS Sbjct: 21 GRAIGAGLFAITPAGERGMCCKAIKLGNARVFPVTTFKTTAS 62 Score = 34.7 bits (76), Expect = 0.078 Identities = 20/46 (43%), Positives = 26/46 (56%) Frame = -3 Query: 653 YNLPFAIQAAQLLERAIGAGPLRYYASWRKGDVLQGD*VG*RQGFP 516 + PFAIQAAQLL RAIGAG + +G + +G + FP Sbjct: 8 HQAPFAIQAAQLLGRAIGAGLFAITPAGERGMCCKAIKLGNARVFP 53 >SB_46185| Best HMM Match : Flt3_lig (HMM E-Value=3.3) Length = 292 Score = 74.5 bits (175), Expect = 8e-14 Identities = 34/50 (68%), Positives = 36/50 (72%), Gaps = 2/50 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRMANC 652 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ C Sbjct: 60 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRC 109 >SB_46589| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 562 Score = 73.7 bits (173), Expect = 1e-13 Identities = 34/53 (64%), Positives = 37/53 (69%), Gaps = 2/53 (3%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRMANCKPL 661 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ P+ Sbjct: 153 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRALPM 205 >SB_40004| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 72.9 bits (171), Expect = 2e-13 Identities = 40/69 (57%), Positives = 48/69 (69%) Frame = -2 Query: 612 KGDRCGASSLLRQLAKGGCAARRLSWVTPGFSQSRVVKRRPVNCNTTHYRANWVPGPPSS 433 +G ASSLLRQLAKGGCAARRLSWVTPGFSQSR KRRPV + H + + PP Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKRRPV--PSLHACRSTLEDPP-F 63 Query: 432 FSETNERQF 406 + T++ Q+ Sbjct: 64 YVMTHQEQY 72 Score = 30.3 bits (65), Expect = 1.7 Identities = 14/43 (32%), Positives = 19/43 (44%) Frame = -1 Query: 628 LRNCWKGRSVRGLFAITPAGERGMCCKAIKLGNARVFPVTRCK 500 LRNCW+GRSVR + + G + + RCK Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_28196| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 72.5 bits (170), Expect = 3e-13 Identities = 35/42 (83%), Positives = 36/42 (85%) Frame = -2 Query: 612 KGDRCGASSLLRQLAKGGCAARRLSWVTPGFSQSRVVKRRPV 487 +G ASSLLRQLAKGGCAARRLSWVTPGFSQSR KRRPV Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKRRPV 48 Score = 30.3 bits (65), Expect = 1.7 Identities = 14/43 (32%), Positives = 19/43 (44%) Frame = -1 Query: 628 LRNCWKGRSVRGLFAITPAGERGMCCKAIKLGNARVFPVTRCK 500 LRNCW+GRSVR + + G + + RCK Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_5984| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 72.5 bits (170), Expect = 3e-13 Identities = 35/42 (83%), Positives = 36/42 (85%) Frame = -2 Query: 612 KGDRCGASSLLRQLAKGGCAARRLSWVTPGFSQSRVVKRRPV 487 +G ASSLLRQLAKGGCAARRLSWVTPGFSQSR KRRPV Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKRRPV 48 Score = 30.3 bits (65), Expect = 1.7 Identities = 14/43 (32%), Positives = 19/43 (44%) Frame = -1 Query: 628 LRNCWKGRSVRGLFAITPAGERGMCCKAIKLGNARVFPVTRCK 500 LRNCW+GRSVR + + G + + RCK Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_2952| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 72.5 bits (170), Expect = 3e-13 Identities = 35/42 (83%), Positives = 36/42 (85%) Frame = -2 Query: 612 KGDRCGASSLLRQLAKGGCAARRLSWVTPGFSQSRVVKRRPV 487 +G ASSLLRQLAKGGCAARRLSWVTPGFSQSR KRRPV Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKRRPV 48 Score = 30.3 bits (65), Expect = 1.7 Identities = 14/43 (32%), Positives = 19/43 (44%) Frame = -1 Query: 628 LRNCWKGRSVRGLFAITPAGERGMCCKAIKLGNARVFPVTRCK 500 LRNCW+GRSVR + + G + + RCK Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_39849| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 68 Score = 72.5 bits (170), Expect = 3e-13 Identities = 35/42 (83%), Positives = 36/42 (85%) Frame = -2 Query: 612 KGDRCGASSLLRQLAKGGCAARRLSWVTPGFSQSRVVKRRPV 487 +G ASSLLRQLAKGGCAARRLSWVTPGFSQSR KRRPV Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKRRPV 48 Score = 30.3 bits (65), Expect = 1.7 Identities = 14/43 (32%), Positives = 19/43 (44%) Frame = -1 Query: 628 LRNCWKGRSVRGLFAITPAGERGMCCKAIKLGNARVFPVTRCK 500 LRNCW+GRSVR + + G + + RCK Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_20378| Best HMM Match : Adeno_E1B_19K (HMM E-Value=5.7) Length = 132 Score = 72.5 bits (170), Expect = 3e-13 Identities = 34/51 (66%), Positives = 36/51 (70%), Gaps = 2/51 (3%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRMANCK 655 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ K Sbjct: 58 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRTK 108 >SB_20313| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 72.5 bits (170), Expect = 3e-13 Identities = 35/42 (83%), Positives = 36/42 (85%) Frame = -2 Query: 612 KGDRCGASSLLRQLAKGGCAARRLSWVTPGFSQSRVVKRRPV 487 +G ASSLLRQLAKGGCAARRLSWVTPGFSQSR KRRPV Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKRRPV 48 Score = 30.3 bits (65), Expect = 1.7 Identities = 14/43 (32%), Positives = 19/43 (44%) Frame = -1 Query: 628 LRNCWKGRSVRGLFAITPAGERGMCCKAIKLGNARVFPVTRCK 500 LRNCW+GRSVR + + G + + RCK Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_501| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 72.5 bits (170), Expect = 3e-13 Identities = 35/42 (83%), Positives = 36/42 (85%) Frame = -2 Query: 612 KGDRCGASSLLRQLAKGGCAARRLSWVTPGFSQSRVVKRRPV 487 +G ASSLLRQLAKGGCAARRLSWVTPGFSQSR KRRPV Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKRRPV 48 Score = 30.3 bits (65), Expect = 1.7 Identities = 14/43 (32%), Positives = 19/43 (44%) Frame = -1 Query: 628 LRNCWKGRSVRGLFAITPAGERGMCCKAIKLGNARVFPVTRCK 500 LRNCW+GRSVR + + G + + RCK Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 72.1 bits (169), Expect = 4e-13 Identities = 33/58 (56%), Positives = 36/58 (62%) Frame = -2 Query: 627 CATVGKGDRCGASSLLRQLAKGGCAARRLSWVTPGFSQSRVVKRRPVNCNTTHYRANW 454 CATVGKGDRCG ++ +G C GF VVKRRPVNCNTTHYRANW Sbjct: 2 CATVGKGDRCGLFAITPAGERGMCCKAIKLGNAKGFPSHDVVKRRPVNCNTTHYRANW 59 >SB_34678| Best HMM Match : Bromodomain (HMM E-Value=9e-25) Length = 1137 Score = 71.7 bits (168), Expect = 6e-13 Identities = 33/51 (64%), Positives = 36/51 (70%), Gaps = 2/51 (3%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRMANCK 655 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ + Sbjct: 536 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRAR 586 Score = 45.2 bits (102), Expect = 6e-05 Identities = 30/78 (38%), Positives = 39/78 (50%) Frame = +3 Query: 432 NSRGGPVXXXXXXXXXXXXLAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRP 611 N RG P+ LAVVLQR + + L L P + ++ RTDRP Sbjct: 512 NQRGDPLESTCRHASLA--LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 569 Query: 612 FQQLRSLNGEWQIVSR*Y 665 QQLRSLNGEW+++ Y Sbjct: 570 SQQLRSLNGEWRLMRARY 587 >SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 69 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 115 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 62 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 116 >SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 32 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 78 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 25 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 79 >SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 56 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 102 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 49 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 103 >SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 35 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 81 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 28 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 82 >SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 23 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 69 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 70 >SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 36 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 82 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 83 >SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 25 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 71 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 18 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 72 >SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 23 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 69 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 70 >SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 917 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 840 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 886 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 833 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 887 >SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 23 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 69 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 70 >SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) Length = 195 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 121 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 167 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 114 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 168 >SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 46 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 92 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 39 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 93 >SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 27 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 73 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 20 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 74 >SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) Length = 349 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 18 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 64 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 11 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 65 >SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 26 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 72 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 19 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 73 >SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 95 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 141 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 88 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 142 >SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 44 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 90 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 37 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 91 >SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 139 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 185 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 132 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 186 >SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 29 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 75 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 22 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 76 >SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) Length = 234 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 160 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 206 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 153 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 207 >SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 64 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 110 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 57 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 111 >SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 28 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 74 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 21 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 75 >SB_51515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 54 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 100 Score = 41.9 bits (94), Expect = 5e-04 Identities = 24/55 (43%), Positives = 32/55 (58%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 L VVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 47 LDVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 101 >SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 67 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 113 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 60 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 114 >SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 23 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 69 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 70 >SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1615 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 220 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 266 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 213 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 267 >SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 88 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 40 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 86 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 33 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 87 >SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 55 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 101 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 48 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 102 >SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 47 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 93 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 40 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 94 >SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 82 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 128 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 75 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 129 >SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 29 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 75 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 22 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 76 >SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 64 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 110 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 57 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 111 >SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016) Length = 318 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 107 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 153 Score = 48.4 bits (110), Expect = 6e-06 Identities = 31/77 (40%), Positives = 42/77 (54%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIVSR*YF 668 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ R Sbjct: 100 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRRQVR 159 Query: 669 GKNRVKIFGKSSLFFNP 719 K R ++ K+ NP Sbjct: 160 AKQR--LYNKAKKSGNP 174 >SB_47276| Best HMM Match : DUF851 (HMM E-Value=9.6) Length = 154 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 80 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 126 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 73 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 127 >SB_46649| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 35 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 81 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 28 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 82 >SB_46412| Best HMM Match : HEAT (HMM E-Value=8) Length = 140 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 66 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 112 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 59 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 113 >SB_46374| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 95 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 141 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 88 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 142 >SB_46344| Best HMM Match : ig (HMM E-Value=0.0082) Length = 181 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 107 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 153 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 100 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 154 >SB_46308| Best HMM Match : IMS (HMM E-Value=0) Length = 1245 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 1197 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 1243 Score = 45.2 bits (102), Expect = 6e-05 Identities = 21/26 (80%), Positives = 22/26 (84%) Frame = -2 Query: 612 KGDRCGASSLLRQLAKGGCAARRLSW 535 +G ASSLLRQLAKGGCAARRLSW Sbjct: 414 EGRSVRASSLLRQLAKGGCAARRLSW 439 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 1190 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 1244 Score = 42.3 bits (95), Expect = 4e-04 Identities = 17/37 (45%), Positives = 22/37 (59%) Frame = -1 Query: 643 HSPFRLRNCWKGRSVRGLFAITPAGERGMCCKAIKLG 533 HSPFRLRNCW+GRSVR + + G + + G Sbjct: 404 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWG 440 >SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 39 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 85 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 32 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 86 >SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 206 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 132 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 178 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 125 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 179 >SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 84 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 130 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 77 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 131 >SB_45291| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 38 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 84 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 31 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 85 >SB_44894| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 23 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 69 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 70 >SB_44606| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 89 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 41 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 87 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 34 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 88 >SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 43 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 89 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 36 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 90 >SB_44358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 103 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 149 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 96 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 150 >SB_43671| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 68 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 114 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 61 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 115 >SB_43630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 91 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 137 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 84 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 138 >SB_43569| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 47 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 93 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 40 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 94 >SB_43145| Best HMM Match : PEGSRP (HMM E-Value=7.2) Length = 165 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 91 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 137 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 84 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 138 >SB_42831| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 91 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 137 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 84 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 138 >SB_42725| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 28 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 74 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 21 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 75 >SB_42655| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 72 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 118 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 65 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 119 >SB_42158| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 31 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 77 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 24 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 78 >SB_42069| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 189 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 115 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 161 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 108 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 162 >SB_41806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 23 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 69 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 70 >SB_41728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 94 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 31 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 77 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 24 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 78 >SB_41712| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 198 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 50 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 96 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 43 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 97 >SB_41481| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 83 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 129 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 76 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 130 >SB_40939| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 74 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 120 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 67 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 121 >SB_40610| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 172 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 98 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 144 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 91 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 145 >SB_40566| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 48 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 94 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 41 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 95 >SB_40462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1580 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 1070 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 1116 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 1063 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 1117 >SB_39373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 24 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 70 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 17 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 71 >SB_38916| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 38 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 84 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 31 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 85 >SB_38016| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 215 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 141 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 187 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 134 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 188 >SB_37690| Best HMM Match : IgG_binding_B (HMM E-Value=4.2) Length = 263 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 189 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 235 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 182 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 236 >SB_37536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 66 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 112 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 59 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 113 >SB_37412| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 26 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 72 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 19 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 73 >SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9) Length = 227 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 153 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 199 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 200 >SB_36865| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 65 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 111 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 58 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 112 >SB_35997| Best HMM Match : Phage_fiber (HMM E-Value=0.78) Length = 197 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 123 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 169 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 116 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 170 >SB_35689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 30 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 76 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 23 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 77 >SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) Length = 1060 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 659 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 705 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 652 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 706 >SB_34829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 46 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 92 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 39 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 93 >SB_34793| Best HMM Match : TIL (HMM E-Value=4.5) Length = 242 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 168 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 214 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 161 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 215 >SB_34683| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 102 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 54 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 100 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 47 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 101 >SB_34501| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 87 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 39 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 85 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 32 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 86 >SB_34015| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 29 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 75 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 22 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 76 >SB_33403| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 65 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 111 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 58 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 112 >SB_33270| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 77 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 123 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 70 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 124 >SB_32674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 24 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 70 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 17 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 71 >SB_32508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 115 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 67 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 113 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 60 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 114 Score = 37.5 bits (83), Expect = 0.011 Identities = 14/17 (82%), Positives = 17/17 (100%) Frame = +2 Query: 545 RLAAHPPFASWRNSEEA 595 +++AHPPFASWRNSEEA Sbjct: 14 QVSAHPPFASWRNSEEA 30 Score = 32.7 bits (71), Expect = 0.32 Identities = 14/19 (73%), Positives = 16/19 (84%) Frame = +3 Query: 585 AKRPRTDRPFQQLRSLNGE 641 ++ RTDRP QQLRSLNGE Sbjct: 27 SEEARTDRPSQQLRSLNGE 45 >SB_32411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 78 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 124 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 71 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 125 >SB_32110| Best HMM Match : PEGSRP (HMM E-Value=9.6) Length = 160 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 86 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 132 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 79 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 133 >SB_31658| Best HMM Match : Arm (HMM E-Value=0.91) Length = 249 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 192 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 238 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 185 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 239 >SB_31227| Best HMM Match : RIO1 (HMM E-Value=0.13) Length = 633 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 451 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 497 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 444 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 498 >SB_31056| Best HMM Match : Virus_P-coat (HMM E-Value=6.4) Length = 154 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 80 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 126 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 73 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 127 >SB_30810| Best HMM Match : JmjC (HMM E-Value=0.0021) Length = 546 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 273 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 319 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 266 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 320 >SB_30786| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 27 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 73 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 20 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 74 >SB_30192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 41 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 87 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 34 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 88 >SB_29084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 116 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 68 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 114 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 61 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 115 >SB_28922| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 77 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 123 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 70 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 124 >SB_28866| Best HMM Match : PhdYeFM (HMM E-Value=8.3) Length = 185 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 111 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 157 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 104 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 158 >SB_28269| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 70 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 116 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 63 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 117 >SB_27927| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 80 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 126 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 73 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 127 >SB_27779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 80 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 126 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 73 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 127 >SB_27619| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 24 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 70 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 17 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 71 >SB_27047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 81 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 127 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 74 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 128 >SB_25936| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 90 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 136 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 83 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 137 >SB_24859| Best HMM Match : HAP (HMM E-Value=6.4) Length = 257 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 183 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 229 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 176 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 230 >SB_24787| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 112 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 38 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 84 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 31 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 85 >SB_24544| Best HMM Match : PSCyt1 (HMM E-Value=4.3) Length = 164 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 90 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 136 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 83 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 137 >SB_24181| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 27 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 73 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 20 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 74 >SB_23437| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 56 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 102 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 49 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 103 >SB_22658| Best HMM Match : Protamine_3 (HMM E-Value=9.6) Length = 128 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 80 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 126 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 73 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 127 >SB_22468| Best HMM Match : CUT (HMM E-Value=6.8) Length = 197 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 149 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 195 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 142 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 196 >SB_22254| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 75 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 121 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 68 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 122 >SB_21247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 64 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 110 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 57 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 111 >SB_20864| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 76 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 122 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 69 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 123 >SB_20839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 27 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 73 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 20 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 74 >SB_20747| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 23 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 69 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 70 >SB_19461| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 108 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 45 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 91 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 38 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 92 >SB_18812| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 51 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 97 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 44 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 98 >SB_18436| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 94 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 46 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRTLNGEWRL 92 Score = 43.2 bits (97), Expect = 2e-04 Identities = 24/55 (43%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLR+LNGEW+++ Sbjct: 39 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRTLNGEWRLM 93 >SB_18289| Best HMM Match : IgG_binding_B (HMM E-Value=7) Length = 143 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 69 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 115 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 62 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 116 >SB_17565| Best HMM Match : EGF (HMM E-Value=5.1e-05) Length = 162 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 88 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 134 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 81 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 135 >SB_16725| Best HMM Match : DAGAT (HMM E-Value=1e-39) Length = 571 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 198 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 244 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 191 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 245 >SB_16155| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 168 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 94 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 140 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 87 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 141 >SB_15873| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 185 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 111 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 157 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 104 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 158 >SB_15493| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 108 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 45 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 91 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 38 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 92 >SB_15346| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 57 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 103 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 50 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 104 >SB_15295| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 56 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 102 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 49 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 103 >SB_15150| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 96 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 48 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 94 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 41 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 95 >SB_15134| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 29 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 75 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 22 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 76 >SB_15127| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 27 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 73 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 20 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 74 >SB_14936| Best HMM Match : Pep_M12B_propep (HMM E-Value=9.7) Length = 207 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 133 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 179 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 126 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 180 >SB_14862| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 50 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 96 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 43 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 97 >SB_14045| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 76 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 122 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 69 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 123 >SB_13480| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 62 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 108 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 55 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 109 >SB_13372| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 25 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 71 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 18 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 72 >SB_13236| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 61 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 107 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 54 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 108 >SB_12962| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 95 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 141 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 88 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 142 >SB_12873| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 62 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 108 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 55 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 109 >SB_12726| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 65 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 111 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 58 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 112 >SB_12236| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 27 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 73 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 20 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 74 >SB_12187| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 101 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 147 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 94 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 148 >SB_12019| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 72 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 118 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 65 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 119 >SB_11632| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 248 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 174 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 220 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 167 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 221 >SB_11249| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 117 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 69 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 115 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 62 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 116 >SB_10911| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 49 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 95 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 42 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 96 >SB_10687| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 24 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 70 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 17 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 71 >SB_10456| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 88 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 40 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 86 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 33 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 87 >SB_10031| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 86 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 132 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 79 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 133 >SB_9995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 64 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 110 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 57 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 111 >SB_9697| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 89 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 41 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 87 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 34 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 88 >SB_9450| Best HMM Match : CM_1 (HMM E-Value=3.1) Length = 186 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 112 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 158 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 105 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 159 >SB_8806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 101 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 53 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 99 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 46 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 100 >SB_8714| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 43 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 89 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 36 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 90 >SB_8621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 200 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 126 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 172 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 119 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 173 >SB_8582| Best HMM Match : CsgG (HMM E-Value=4.9e-06) Length = 233 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 159 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 205 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 152 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 206 >SB_8530| Best HMM Match : ThiC (HMM E-Value=2.7e-07) Length = 183 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 109 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 155 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 102 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 156 >SB_8498| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 115 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 41 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 87 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 34 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 88 >SB_7973| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 33 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 79 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 26 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 80 >SB_7142| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 62 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 108 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 55 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 109 >SB_6842| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 44 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 90 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 37 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 91 >SB_6464| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 63 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 109 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 56 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 110 >SB_6117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 211 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 163 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 209 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 156 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 210 >SB_6070| Best HMM Match : PEGSRP (HMM E-Value=3.8) Length = 82 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 34 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 80 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 27 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 81 >SB_5521| Best HMM Match : SWIM (HMM E-Value=6.9) Length = 150 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 76 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 122 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 69 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 123 >SB_5457| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 207 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 133 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 179 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 126 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 180 >SB_4705| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 65 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 111 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 58 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 112 >SB_4191| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 96 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 142 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 89 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 143 >SB_3728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 25 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 71 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 18 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 72 >SB_3676| Best HMM Match : Cuticle_2 (HMM E-Value=3.2) Length = 322 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 33 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 79 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 26 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 80 >SB_2468| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 287 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 78 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 124 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 71 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 125 >SB_2230| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 92 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 138 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 85 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 139 >SB_1204| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 51 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 97 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 44 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 98 >SB_965| Best HMM Match : IgG_binding_B (HMM E-Value=8.5) Length = 174 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 100 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 146 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 93 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 147 >SB_58797| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 200 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 152 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 198 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 145 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 199 >SB_55925| Best HMM Match : Homeobox (HMM E-Value=1e-26) Length = 1064 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 798 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 844 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 791 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 845 >SB_55779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 79 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 125 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 72 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 126 >SB_55121| Best HMM Match : DUF971 (HMM E-Value=8.5) Length = 174 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 100 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 146 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 93 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 147 >SB_55030| Best HMM Match : Toxin_27 (HMM E-Value=1.2) Length = 110 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 62 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 108 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 55 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 109 >SB_54995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 114 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 160 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 107 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 161 >SB_54425| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 23 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 69 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 70 >SB_53532| Best HMM Match : IgG_binding_B (HMM E-Value=7.8) Length = 162 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 88 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 134 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 81 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 135 >SB_52081| Best HMM Match : DUF1634 (HMM E-Value=0.55) Length = 189 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 115 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 161 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 108 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 162 >SB_51954| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 23 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 69 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 70 >SB_51949| Best HMM Match : Toxin_14 (HMM E-Value=0.051) Length = 387 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 313 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 359 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 306 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 360 >SB_51253| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 85 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 37 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 83 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 30 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 84 >SB_49112| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 59 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 105 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 52 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 106 >SB_48731| Best HMM Match : zf-C3HC4 (HMM E-Value=6.5e-08) Length = 688 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 22 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 68 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 15 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 69 >SB_48358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 96 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 33 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 79 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 26 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 80 >SB_45537| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 23 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 69 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 70 >SB_45065| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 63 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 109 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 56 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 110 >SB_44400| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 328 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 254 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 300 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 247 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 301 >SB_43660| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 88 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 134 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 81 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 135 >SB_43339| Best HMM Match : SAC3_GANP (HMM E-Value=1.8e-09) Length = 657 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 41 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 87 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 34 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 88 >SB_42664| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 55 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 101 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 48 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 102 >SB_42518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 23 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 69 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 70 >SB_41564| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 31 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 77 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 24 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 78 >SB_41244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 268 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 211 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 257 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 204 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 258 >SB_40229| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 70 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 116 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 63 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 117 >SB_39279| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 25 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 71 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 18 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 72 >SB_36908| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 90 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 42 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 88 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 35 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 89 >SB_36598| Best HMM Match : E-MAP-115 (HMM E-Value=0.092) Length = 783 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 726 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 772 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 719 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 773 >SB_35835| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 46 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 92 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 39 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 93 >SB_34602| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 44 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 90 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 37 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 91 >SB_32133| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 23 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 69 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 70 >SB_31775| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 551 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 194 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 240 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 187 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 241 >SB_31269| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 23 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 69 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 70 >SB_30891| Best HMM Match : LIM (HMM E-Value=4.40008e-43) Length = 511 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 122 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 168 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 115 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 169 >SB_30664| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 37 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 83 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 30 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 84 >SB_28552| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 27 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 73 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 20 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 74 >SB_27244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 92 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 138 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 85 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 139 >SB_27230| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 66 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 18 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 64 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 11 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 65 >SB_26386| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 39 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 85 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 32 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 86 >SB_25785| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 190 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 116 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 162 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 109 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 163 >SB_22440| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 28 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 74 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 21 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 75 >SB_20758| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 44 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 90 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 37 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 91 >SB_20620| Best HMM Match : zf-HIT (HMM E-Value=8.5e-10) Length = 567 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 205 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 251 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 198 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 252 >SB_19831| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 67 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 113 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 60 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 114 >SB_19310| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 28 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 74 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 21 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 75 >SB_19077| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 23 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 69 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 70 >SB_15849| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 82 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 34 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 80 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 27 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 81 >SB_14754| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 48 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 94 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 41 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 95 >SB_12231| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 509 RDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFPTV--AQPEWRM 643 RDWENPGVTQLNRLAAHPPFASWRNSEEA P + EWR+ Sbjct: 27 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 73 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 489 LAVVLQRVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPFQQLRSLNGEWQIV 653 LAVVLQR + + L L P + ++ RTDRP QQLRSLNGEW+++ Sbjct: 20 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 74 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,990,655 Number of Sequences: 59808 Number of extensions: 492795 Number of successful extensions: 9173 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 5098 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9140 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1962001171 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -