BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0239 (733 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC029528-1|AAH29528.1| 379|Homo sapiens sperm associated antige... 31 3.2 BC026118-1|AAH26118.1| 379|Homo sapiens sperm associated antige... 31 3.2 AL139826-2|CAI16148.1| 379|Homo sapiens sperm associated antige... 31 3.2 AL139826-1|CAI16147.1| 354|Homo sapiens sperm associated antige... 31 3.2 AL121756-4|CAI22528.1| 379|Homo sapiens sperm associated antige... 31 3.2 AL121756-3|CAI22529.1| 354|Homo sapiens sperm associated antige... 31 3.2 AF401350-1|AAM90665.1| 379|Homo sapiens testis and spermatogene... 31 3.2 >BC029528-1|AAH29528.1| 379|Homo sapiens sperm associated antigen 4-like protein. Length = 379 Score = 31.5 bits (68), Expect = 3.2 Identities = 15/35 (42%), Positives = 20/35 (57%) Frame = +2 Query: 512 DWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFP 616 +W NPG T L R+ H A R E PH++P+P Sbjct: 345 NWGNPGFTCLYRVRVHGSVAPPR---EQPHQNPYP 376 >BC026118-1|AAH26118.1| 379|Homo sapiens sperm associated antigen 4-like protein. Length = 379 Score = 31.5 bits (68), Expect = 3.2 Identities = 15/35 (42%), Positives = 20/35 (57%) Frame = +2 Query: 512 DWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFP 616 +W NPG T L R+ H A R E PH++P+P Sbjct: 345 NWGNPGFTCLYRVRVHGSVAPPR---EQPHQNPYP 376 >AL139826-2|CAI16148.1| 379|Homo sapiens sperm associated antigen 4-like protein. Length = 379 Score = 31.5 bits (68), Expect = 3.2 Identities = 15/35 (42%), Positives = 20/35 (57%) Frame = +2 Query: 512 DWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFP 616 +W NPG T L R+ H A R E PH++P+P Sbjct: 345 NWGNPGFTCLYRVRVHGSVAPPR---EQPHQNPYP 376 >AL139826-1|CAI16147.1| 354|Homo sapiens sperm associated antigen 4-like protein. Length = 354 Score = 31.5 bits (68), Expect = 3.2 Identities = 15/35 (42%), Positives = 20/35 (57%) Frame = +2 Query: 512 DWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFP 616 +W NPG T L R+ H A R E PH++P+P Sbjct: 320 NWGNPGFTCLYRVRVHGSVAPPR---EQPHQNPYP 351 >AL121756-4|CAI22528.1| 379|Homo sapiens sperm associated antigen 4-like protein. Length = 379 Score = 31.5 bits (68), Expect = 3.2 Identities = 15/35 (42%), Positives = 20/35 (57%) Frame = +2 Query: 512 DWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFP 616 +W NPG T L R+ H A R E PH++P+P Sbjct: 345 NWGNPGFTCLYRVRVHGSVAPPR---EQPHQNPYP 376 >AL121756-3|CAI22529.1| 354|Homo sapiens sperm associated antigen 4-like protein. Length = 354 Score = 31.5 bits (68), Expect = 3.2 Identities = 15/35 (42%), Positives = 20/35 (57%) Frame = +2 Query: 512 DWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFP 616 +W NPG T L R+ H A R E PH++P+P Sbjct: 320 NWGNPGFTCLYRVRVHGSVAPPR---EQPHQNPYP 351 >AF401350-1|AAM90665.1| 379|Homo sapiens testis and spermatogenesis related gene 4 protein. Length = 379 Score = 31.5 bits (68), Expect = 3.2 Identities = 15/35 (42%), Positives = 20/35 (57%) Frame = +2 Query: 512 DWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPFP 616 +W NPG T L R+ H A R E PH++P+P Sbjct: 345 NWGNPGFTCLYRVRVHGSVAPPR---EQPHQNPYP 376 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 111,092,697 Number of Sequences: 237096 Number of extensions: 2536859 Number of successful extensions: 4370 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 4214 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4370 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 8679165170 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -