BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0237 (700 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g26230.1 68418.m03123 expressed protein predicted protein, Ar... 32 0.32 At2g20960.1 68415.m02479 expressed protein pEARLI 4 gene product... 32 0.42 At5g64650.1 68418.m08125 ribosomal protein L17 family protein co... 31 0.73 At5g01280.1 68418.m00037 expressed protein 31 0.73 At3g49390.1 68416.m05399 RNA-binding protein, putative RNA-bindi... 31 0.97 At2g40070.1 68415.m04923 expressed protein 31 0.97 At2g36720.1 68415.m04505 PHD finger transcription factor, putative 31 0.97 At5g67170.2 68418.m08468 SEC-C motif-containing protein / OTU-li... 30 1.3 At5g67170.1 68418.m08467 SEC-C motif-containing protein / OTU-li... 30 1.3 At3g29710.1 68416.m03745 hypothetical protein contains Pfam prof... 30 1.3 At1g49270.1 68414.m05524 protein kinase family protein contains ... 30 1.7 At1g34120.1 68414.m04231 inositol polyphosphate 5-phosphatase I ... 29 2.2 At5g26320.1 68418.m03146 meprin and TRAF homology domain-contain... 29 3.0 At3g60410.2 68416.m06757 expressed protein 29 3.0 At3g60410.1 68416.m06756 expressed protein 29 3.0 At3g51130.1 68416.m05599 expressed protein contains Pfam PF03676... 29 3.0 At2g29210.1 68415.m03550 splicing factor PWI domain-containing p... 29 3.0 At1g55540.1 68414.m06356 proline-rich family protein contains pr... 29 3.0 At1g14740.1 68414.m01762 expressed protein 29 3.0 At5g37630.1 68418.m04532 chromosome condensation family protein ... 29 3.9 At5g16730.1 68418.m01959 expressed protein weak similarity to mi... 28 5.2 At4g26650.1 68417.m03840 RNA recognition motif (RRM)-containing ... 28 5.2 At4g20160.1 68417.m02949 expressed protein ; expression supporte... 28 5.2 At3g04790.1 68416.m00516 ribose 5-phosphate isomerase-related si... 28 5.2 At5g60210.1 68418.m07547 cytoplasmic linker protein-related cont... 28 6.8 At4g15840.1 68417.m02409 expressed protein 28 6.8 At3g19830.1 68416.m02512 C2 domain-containing protein low simila... 28 6.8 At3g09000.1 68416.m01053 proline-rich family protein 28 6.8 At3g54790.1 68416.m06063 armadillo/beta-catenin repeat family pr... 27 9.0 At3g46540.1 68416.m05052 epsin N-terminal homology (ENTH) domain... 27 9.0 At3g08670.1 68416.m01007 expressed protein 27 9.0 At2g34830.1 68415.m04276 WRKY family transcription factor 27 9.0 At2g22100.1 68415.m02625 RNA recognition motif (RRM)-containing ... 27 9.0 At1g35660.1 68414.m04432 expressed protein 27 9.0 >At5g26230.1 68418.m03123 expressed protein predicted protein, Arabidopsis thaliana Length = 341 Score = 32.3 bits (70), Expect = 0.32 Identities = 34/114 (29%), Positives = 49/114 (42%), Gaps = 1/114 (0%) Frame = +1 Query: 25 RSPDRSDTNSPRSAVSTPNSNSSINVTDQSISLSQQNLETLNRMGMFFHAQQMQLNQSFD 204 R P R NSP + S+P+S+SS + SIS + + +F+ Q + L S Sbjct: 3 RQPPRP-RNSPPQSHSSPSSSSSEFEFNISISPRKASSSLCPADELFYKGQLLPLQLS-- 59 Query: 205 VKRLGLTQVPGASQGPSTV*TRSSAS-ALRGRPDSVSSSRGERSATPSPSPREP 363 RL L + G+S S + SS+S A DS S+ S P P Sbjct: 60 -PRLSLVRTLGSSTSSSDYTSSSSSSVATSAARDSTESNSSTDSTASFPLLHPP 112 >At2g20960.1 68415.m02479 expressed protein pEARLI 4 gene product [Arabidopsis thaliana] GI:871782 Length = 748 Score = 31.9 bits (69), Expect = 0.42 Identities = 20/49 (40%), Positives = 24/49 (48%), Gaps = 3/49 (6%) Frame = +1 Query: 250 PSTV*TRSSASALRGR-PDSVSSSRGERSATPSPSPR--EPSKALARVR 387 P T TR + RGR P+ + S G RS TP P P EPS + R Sbjct: 286 PQTPETRPRTAQRRGRSPEFMERSPGPRSKTPEPQPTYFEPSSRTPKQR 334 >At5g64650.1 68418.m08125 ribosomal protein L17 family protein contains Pfam profile: PF01196 ribosomal protein L17 Length = 160 Score = 31.1 bits (67), Expect = 0.73 Identities = 17/43 (39%), Positives = 21/43 (48%) Frame = +1 Query: 301 DSVSSSRGERSATPSPSPREPSKALARVRVTVMMATTRELMTS 429 D + R + ATP P PR P AR R+T A +E TS Sbjct: 114 DRENELRQSKPATPQPPPRVPLDPWARSRLTRQYAPPKEEKTS 156 >At5g01280.1 68418.m00037 expressed protein Length = 460 Score = 31.1 bits (67), Expect = 0.73 Identities = 21/54 (38%), Positives = 27/54 (50%), Gaps = 1/54 (1%) Frame = +1 Query: 271 SSASALRGRPDSVSSSRG-ERSATPSPSPREPSKALARVRVTVMMATTRELMTS 429 SS S +R RP S SSSR R TP+ + P+K + TTR +TS Sbjct: 77 SSVSGIR-RPSSSSSSRSTSRPPTPTRKSKTPAKRPSTPTSRATSTTTRATLTS 129 >At3g49390.1 68416.m05399 RNA-binding protein, putative RNA-binding protein RBP37, Arabidopsis thaliana, PIR:T04196 Length = 353 Score = 30.7 bits (66), Expect = 0.97 Identities = 16/42 (38%), Positives = 23/42 (54%) Frame = +1 Query: 25 RSPDRSDTNSPRSAVSTPNSNSSINVTDQSISLSQQNLETLN 150 + P D SP+S STP + S TD I+ + Q ++TLN Sbjct: 32 KPPCPDDDQSPKSDSSTPLTIDSTPETDDRINETAQKVQTLN 73 Score = 28.3 bits (60), Expect = 5.2 Identities = 13/32 (40%), Positives = 22/32 (68%) Frame = +1 Query: 22 DRSPDRSDTNSPRSAVSTPNSNSSINVTDQSI 117 D+SP +SD+++P + STP ++ IN T Q + Sbjct: 39 DQSP-KSDSSTPLTIDSTPETDDRINETAQKV 69 >At2g40070.1 68415.m04923 expressed protein Length = 607 Score = 30.7 bits (66), Expect = 0.97 Identities = 20/51 (39%), Positives = 31/51 (60%) Frame = +1 Query: 241 SQGPSTV*TRSSASALRGRPDSVSSSRGERSATPSPSPREPSKALARVRVT 393 S PST +R++ S+ RP S+++SR SAT P+P S +L+ R+T Sbjct: 202 SSRPSTPTSRATVSSAT-RP-SLTNSRSTVSATTKPTPMSRSTSLSSSRLT 250 >At2g36720.1 68415.m04505 PHD finger transcription factor, putative Length = 1007 Score = 30.7 bits (66), Expect = 0.97 Identities = 10/36 (27%), Positives = 16/36 (44%) Frame = -2 Query: 489 CVSSCCPWTAVACRRRYPVATCHQFSGCSHHYCYTN 382 C S C W V ++ + C Q+ S + C+ N Sbjct: 302 CSCSSCDWANVISTSKFEIHACKQYRRASQYICFEN 337 >At5g67170.2 68418.m08468 SEC-C motif-containing protein / OTU-like cysteine protease family protein contains Pfam profiles PF02338: OTU-like cysteine protease, PF02810: SEC-C motif Length = 374 Score = 30.3 bits (65), Expect = 1.3 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = -1 Query: 178 VARERTCPCG*ESPSSAATGISTGRS 101 + R +TCPCG + + G +TGRS Sbjct: 310 IPRNKTCPCGSKKKYKSCCGTATGRS 335 >At5g67170.1 68418.m08467 SEC-C motif-containing protein / OTU-like cysteine protease family protein contains Pfam profiles PF02338: OTU-like cysteine protease, PF02810: SEC-C motif Length = 375 Score = 30.3 bits (65), Expect = 1.3 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = -1 Query: 178 VARERTCPCG*ESPSSAATGISTGRS 101 + R +TCPCG + + G +TGRS Sbjct: 311 IPRNKTCPCGSKKKYKSCCGTATGRS 336 >At3g29710.1 68416.m03745 hypothetical protein contains Pfam profile PF03384: Drosophila protein of unknown function, DUF287 Length = 669 Score = 30.3 bits (65), Expect = 1.3 Identities = 17/62 (27%), Positives = 31/62 (50%), Gaps = 2/62 (3%) Frame = +3 Query: 366 ESAGEGSCNSNDGYN--QRTDDKSPPGSDDDTPQQSTDNKKKHRRN*TTLQPTSFMSWSA 539 ES GEG+ ++G + ++DK +++ +P Q+T TT PT+ +A Sbjct: 41 ESEGEGAGEESEGSGAVEESEDKEKVPAEEQSPTQTTATAMATNAAPTTAAPTTTAPTTA 100 Query: 540 PS 545 P+ Sbjct: 101 PT 102 >At1g49270.1 68414.m05524 protein kinase family protein contains Pfam domain PF00069: Protein kinase domain Length = 699 Score = 29.9 bits (64), Expect = 1.7 Identities = 17/60 (28%), Positives = 27/60 (45%) Frame = +3 Query: 318 QRREECDPVPVSPGAVESAGEGSCNSNDGYNQRTDDKSPPGSDDDTPQQSTDNKKKHRRN 497 Q+++E P P+ + S G S + + + +SPP PQQS +N K N Sbjct: 57 QQQQESPPPPLPENS--SDGSSSSSPPPPSDSSSQSQSPPPPSTSPPQQSDNNGNKGNNN 114 >At1g34120.1 68414.m04231 inositol polyphosphate 5-phosphatase I (IP5PI) nearly identical to inositol polyphosphate 5-phosphatase I [Arabidopsis thaliana] GI:10444261 Length = 586 Score = 29.5 bits (63), Expect = 2.2 Identities = 14/42 (33%), Positives = 22/42 (52%) Frame = +3 Query: 369 SAGEGSCNSNDGYNQRTDDKSPPGSDDDTPQQSTDNKKKHRR 494 S + S +S+D Y R+ + P S P+ TD++ K RR Sbjct: 44 SESDYSADSDDDYEDRSQEFDPISSGVTNPRVDTDDRPKLRR 85 >At5g26320.1 68418.m03146 meprin and TRAF homology domain-containing protein / MATH domain-containing protein similar to ubiquitin-specific protease 12 [Arabidopsis thaliana] GI:11993471; contains Pfam profile PF00917: MATH domain Length = 352 Score = 29.1 bits (62), Expect = 3.0 Identities = 17/50 (34%), Positives = 29/50 (58%), Gaps = 1/50 (2%) Frame = +1 Query: 181 MQLNQSFDVK-RLGLTQVPGASQGPSTV*TRSSASALRGRPDSVSSSRGE 327 ++ N S+ +K LGLT+V + S + T +S S ++GR ++ SS E Sbjct: 36 IEYNNSYSLKTNLGLTRVLREERPSSKIVTITSFSVIKGRSEAFESSTFE 85 >At3g60410.2 68416.m06757 expressed protein Length = 324 Score = 29.1 bits (62), Expect = 3.0 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = +1 Query: 289 RGRPDSVSSSRGERSATPSPSPREPSKALARVR 387 +G VS S +RSAT S +P SK R+R Sbjct: 113 KGNASGVSDSAADRSATKSTTPDGRSKIFIRIR 145 >At3g60410.1 68416.m06756 expressed protein Length = 324 Score = 29.1 bits (62), Expect = 3.0 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = +1 Query: 289 RGRPDSVSSSRGERSATPSPSPREPSKALARVR 387 +G VS S +RSAT S +P SK R+R Sbjct: 113 KGNASGVSDSAADRSATKSTTPDGRSKIFIRIR 145 >At3g51130.1 68416.m05599 expressed protein contains Pfam PF03676: Uncharacterised protein family (UPF0183) Length = 410 Score = 29.1 bits (62), Expect = 3.0 Identities = 16/41 (39%), Positives = 24/41 (58%) Frame = +1 Query: 172 AQQMQLNQSFDVKRLGLTQVPGASQGPSTV*TRSSASALRG 294 +Q+++L + FDVKRL + GPST+ T + AL G Sbjct: 95 SQRLRLVEIFDVKRLQMRYATSMIGGPSTLATFVAVYALFG 135 >At2g29210.1 68415.m03550 splicing factor PWI domain-containing protein contains Pfam profile PF01480: PWI domain Length = 878 Score = 29.1 bits (62), Expect = 3.0 Identities = 20/55 (36%), Positives = 30/55 (54%), Gaps = 4/55 (7%) Frame = +1 Query: 202 DVKRLGLTQVPGASQGPSTV*TRSSASALRGRPDSVSSSRGERSATP----SPSP 354 D +R+ L+Q G PS + S S +RGR S SSR +++ +P SP+P Sbjct: 535 DEERVSLSQ-GGRHTSPSHIKQDGSMSPVRGRGKSSPSSRHQKARSPVRRRSPTP 588 >At1g55540.1 68414.m06356 proline-rich family protein contains proline rich extensin domain, INTERPRO:IPR002965 Length = 915 Score = 29.1 bits (62), Expect = 3.0 Identities = 31/115 (26%), Positives = 47/115 (40%), Gaps = 1/115 (0%) Frame = +1 Query: 13 FFADRSPDRSDTNSPRSAVSTPNSNSSINVTDQSISLSQQNLETLN-RMGMFFHAQQMQL 189 F A +P S + P A S P S++ + T S S + N G + ++ L Sbjct: 356 FTASSAPVSSSSQDPVPA-SIPISSAPVPQTFSVTSTSTVSATGFNVPFGKPLTSVKVDL 414 Query: 190 NQSFDVKRLGLTQVPGASQGPSTV*TRSSASALRGRPDSVSSSRGERSATPSPSP 354 NQ+ P S GP+ T + + P+ VSSS G+ S P +P Sbjct: 415 NQA-------APSTPSPSPGPTAGFTFNLPALSPSSPEMVSSSTGQSSLFPPSAP 462 >At1g14740.1 68414.m01762 expressed protein Length = 733 Score = 29.1 bits (62), Expect = 3.0 Identities = 19/56 (33%), Positives = 31/56 (55%), Gaps = 2/56 (3%) Frame = -3 Query: 242 LAPGTWVKPSRFTSKL*FNCICCA*KNMPMRLRVSKF-CCDRDIDWSV-TFIEELE 81 + PG +K R T+++ F+CI CA K+ F CC + +W + T I+EL+ Sbjct: 475 IKPGHSLKGQRGTTEMMFHCIGCAHKSEMFGFVKDVFVCCAK--NWGLETLIKELD 528 >At5g37630.1 68418.m04532 chromosome condensation family protein contains pfam profile: PF04154 chromosome condensation protein 3, C-terminal region Length = 1051 Score = 28.7 bits (61), Expect = 3.9 Identities = 23/93 (24%), Positives = 39/93 (41%), Gaps = 4/93 (4%) Frame = +1 Query: 178 QMQLNQSFDVK----RLGLTQVPGASQGPSTV*TRSSASALRGRPDSVSSSRGERSATPS 345 Q Q N F++ L +T+ Q P+ T+ + S R R + SS E S Sbjct: 940 QDQANSIFEILGVSYNLEITETTTVPQTPAPCSTKPARSRRRARIEETSSDEEE---VAS 996 Query: 346 PSPREPSKALARVRVTVMMATTRELMTSRHRVA 444 P P P+ + R A ++M S+ +++ Sbjct: 997 PPPSAPNTLMTRSHRASKAAALAKIMASKVKMS 1029 >At5g16730.1 68418.m01959 expressed protein weak similarity to microtubule binding protein D-CLIP-190 [Drosophila melanogaster] GI:2773363, SMC2-like condensin [Arabidopsis thaliana] GI:14279543 Length = 853 Score = 28.3 bits (60), Expect = 5.2 Identities = 23/61 (37%), Positives = 30/61 (49%), Gaps = 1/61 (1%) Frame = +1 Query: 241 SQGPSTV*TRSSASALRGRPDSVSSSRGERSATPSPSPREPSKA-LARVRVTVMMATTRE 417 + PST S S R P+S SS ER + P+P E S+A +A V+ T TT Sbjct: 42 NNSPSTTTPHSRLSLDRSSPNSKSSV--ERRSPKLPTPPEKSQARVAAVKGTESPQTTTR 99 Query: 418 L 420 L Sbjct: 100 L 100 >At4g26650.1 68417.m03840 RNA recognition motif (RRM)-containing protein contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 455 Score = 28.3 bits (60), Expect = 5.2 Identities = 27/111 (24%), Positives = 49/111 (44%), Gaps = 5/111 (4%) Frame = +1 Query: 31 PDRSDTNSPRSAVSTPNSNSSINVTDQSISLSQQNLETLNRMGMFFHAQQMQLNQSFDVK 210 P+RS NS ++ +N+++ + + + G+ + Q++ LN +FD Sbjct: 223 PNRSSANSYFNSFPPGYNNNNLGSAGRFSPIGSGR-NAFSSFGLGLN-QELNLNSNFDGN 280 Query: 211 RLGLTQVPGASQGPSTV*TRSSASALRGRPDSV--SSSR---GERSATPSP 348 LG +++PG S R ++ R DS S+R G RS + P Sbjct: 281 TLGYSRIPGNQYFNSASPNRYNSPIGYNRGDSAYNPSNRDLWGNRSDSSGP 331 >At4g20160.1 68417.m02949 expressed protein ; expression supported by MPSS Length = 1188 Score = 28.3 bits (60), Expect = 5.2 Identities = 30/114 (26%), Positives = 47/114 (41%), Gaps = 2/114 (1%) Frame = +1 Query: 82 SNSSINVTDQSISLSQQNLETLNRMGMFFHAQQMQLNQSFDVKRLGLTQVPGASQGPSTV 261 +N++ NV + ++ ++NL R H + ++ DV + VP S S+V Sbjct: 39 NNNNNNVRNIHVAAFEKNLNVFVRD----HLENCSVSVD-DVVDDSIKAVPECSSNKSSV 93 Query: 262 *TRSSASALRGRPD--SVSSSRGERSATPSPSPREPSKALARVRVTVMMATTRE 417 + R D S SSS G S S P PS+ A V + A T + Sbjct: 94 SDHRLSKTEESRQDVPSSSSSLGSDSDPNSGQPENPSRNAASSLVQIWEARTTQ 147 >At3g04790.1 68416.m00516 ribose 5-phosphate isomerase-related similar to ribose-5-phosphate isomerase GI:18654317 from [Spinacia oleracea] Length = 276 Score = 28.3 bits (60), Expect = 5.2 Identities = 14/37 (37%), Positives = 25/37 (67%) Frame = +1 Query: 37 RSDTNSPRSAVSTPNSNSSINVTDQSISLSQQNLETL 147 R+ + + RS S+P ++ S +V QS++LSQ +L+ L Sbjct: 15 RTPSIALRSTGSSPRTSVSFSVKAQSVALSQDDLKKL 51 >At5g60210.1 68418.m07547 cytoplasmic linker protein-related contains weak similarity to cytoplasmic linker protein CLIP-170 (GI:2905649) [Gallus gallus] Length = 588 Score = 27.9 bits (59), Expect = 6.8 Identities = 19/70 (27%), Positives = 29/70 (41%) Frame = +1 Query: 22 DRSPDRSDTNSPRSAVSTPNSNSSINVTDQSISLSQQNLETLNRMGMFFHAQQMQLNQSF 201 D+SP+ + SPRS VS S I + +S Q+ L+ + Q Q Sbjct: 72 DKSPNVLNRRSPRSPVSEKKRPSRITELELLVSQLQEELKKAKDQISVSETSKKQAEQEA 131 Query: 202 DVKRLGLTQV 231 + R L +V Sbjct: 132 EESRKQLQEV 141 >At4g15840.1 68417.m02409 expressed protein Length = 660 Score = 27.9 bits (59), Expect = 6.8 Identities = 18/61 (29%), Positives = 28/61 (45%) Frame = +1 Query: 184 QLNQSFDVKRLGLTQVPGASQGPSTV*TRSSASALRGRPDSVSSSRGERSATPSPSPREP 363 +++QS ++ + GLT + G SQG S V R + RG + P+EP Sbjct: 401 RIDQSGEISKDGLTALVGLSQGTSGV-------GNNPRGEQTEGGRGSGATVGMSEPKEP 453 Query: 364 S 366 S Sbjct: 454 S 454 >At3g19830.1 68416.m02512 C2 domain-containing protein low similarity to GLUT4 vesicle protein [Rattus norvegicus] GI:4193489; contains Pfam profile PF00168: C2 domain Length = 666 Score = 27.9 bits (59), Expect = 6.8 Identities = 15/42 (35%), Positives = 22/42 (52%) Frame = -1 Query: 214 AASRQNFDSIAFVARERTCPCG*ESPSSAATGISTGRSRLLR 89 ++S +FD +FV+R CPC E + T R R+LR Sbjct: 6 SSSCSSFDFPSFVSRRLLCPCSNEHGLIVFSDGFTKRRRILR 47 >At3g09000.1 68416.m01053 proline-rich family protein Length = 541 Score = 27.9 bits (59), Expect = 6.8 Identities = 24/69 (34%), Positives = 32/69 (46%), Gaps = 1/69 (1%) Frame = +1 Query: 229 VPGASQGPSTV*TRSSASALRGRPDSVSSSRG-ERSATPSPSPREPSKALARVRVTVMMA 405 V G + P T + SS + LR RP S SSR R ATP+ P+ + +R T Sbjct: 127 VSGNNNKPQT--SSSSVAGLR-RPSSSGSSRSTSRPATPTRRSTTPTTSTSRPVTTRASN 183 Query: 406 TTRELMTSR 432 + TSR Sbjct: 184 SRSSTPTSR 192 >At3g54790.1 68416.m06063 armadillo/beta-catenin repeat family protein / U-box domain-containing protein contains Pfam domain, PF00514: Armadillo/beta-catenin-like repeats and Pfam, PF04564: U-box domain Length = 760 Score = 27.5 bits (58), Expect = 9.0 Identities = 15/45 (33%), Positives = 24/45 (53%) Frame = +3 Query: 36 SLRYQQPPLGRQHAQLQLLNKRDRPVDIPVAAELGDSQPHGHVLS 170 SL Y + L ++HA LLN ++ + E+G +P HVL+ Sbjct: 521 SLLYSEEKLTQEHAVTALLNLSISELNKAMIVEVGAIEPLVHVLN 565 >At3g46540.1 68416.m05052 epsin N-terminal homology (ENTH) domain-containing protein / clathrin assembly protein-related contains Pfam PF01417: ENTH domain. ENTH (Epsin N-terminal homology) domain; similar to Chain A Of The Epsin N-Terminal Homology (Enth) Domain (GI:8569264) [Rattus Norvegicus]; similar to Af10-protein (GI:1724114) [Avena fatua] Length = 307 Score = 27.5 bits (58), Expect = 9.0 Identities = 17/58 (29%), Positives = 29/58 (50%), Gaps = 4/58 (6%) Frame = -3 Query: 434 WRLVISSLVVAIITVTRTLASAFDGSRGDGDGVALLSPLLELTES----GLPLRAEAE 273 WR+ +SL+V +T S D +GD D ++ + ++ E GL +R +AE Sbjct: 98 WRMAYNSLIVVEHLLTHGPESVSDEFQGDIDVISQMQTFQQIDEKGFNWGLAVRKKAE 155 >At3g08670.1 68416.m01007 expressed protein Length = 567 Score = 27.5 bits (58), Expect = 9.0 Identities = 27/108 (25%), Positives = 46/108 (42%), Gaps = 2/108 (1%) Frame = +1 Query: 49 NSPRSAVSTPNSNSSINVTDQSISLSQQNLETLNRMGMFFHAQQMQLNQSFDVKRLGLTQ 228 N S+++ P SS + S S+ + ++++ +H+ + + S + +Q Sbjct: 111 NDSHSSLAAPKIASSARAS----SASKASRLSVSQSESGYHSSRPARSSSVTRPSISTSQ 166 Query: 229 VPGASQG--PSTV*TRSSASALRGRPDSVSSSRGERSATPSPSPREPS 366 + G PS++ SSAS S SSR SA PS R S Sbjct: 167 YSSFTSGRSPSSILNTSSASVSSYIRPSSPSSRSSSSARPSTPTRTSS 214 >At2g34830.1 68415.m04276 WRKY family transcription factor Length = 427 Score = 27.5 bits (58), Expect = 9.0 Identities = 12/31 (38%), Positives = 20/31 (64%) Frame = +1 Query: 46 TNSPRSAVSTPNSNSSINVTDQSISLSQQNL 138 TNSPR+ + N+N++ + + IS S +NL Sbjct: 153 TNSPRNCLLVDNNNNTSSCSQVQISSSPRNL 183 >At2g22100.1 68415.m02625 RNA recognition motif (RRM)-containing protein similar to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains Pfam profile: PF00076 RNA recognition motif (aka RRM, RBD, or RNP domain) Length = 382 Score = 27.5 bits (58), Expect = 9.0 Identities = 13/44 (29%), Positives = 25/44 (56%) Frame = +3 Query: 366 ESAGEGSCNSNDGYNQRTDDKSPPGSDDDTPQQSTDNKKKHRRN 497 E E S + Y + +++ P S +P++S ++KKKH+R+ Sbjct: 47 EEKPEKSKKKSKKYEEVEEEEKSP-SPSPSPKKSKESKKKHKRS 89 >At1g35660.1 68414.m04432 expressed protein Length = 1155 Score = 27.5 bits (58), Expect = 9.0 Identities = 19/76 (25%), Positives = 31/76 (40%), Gaps = 5/76 (6%) Frame = +3 Query: 321 RREECDPVPVSPGAVESAGEGSC--NSNDGYNQRTDDK--SPPGSDDDTPQQS-TDNKKK 485 R E CD P E S + ++ DD+ P GS + Q KKK Sbjct: 219 RMEACDIPPTHREHTEKRSSSSALPAGENSHDNAPDDRLDKPAGSSKQSKQDGFICEKKK 278 Query: 486 HRRN*TTLQPTSFMSW 533 ++N ++P + ++W Sbjct: 279 SKKNKAGVEPVTPLTW 294 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,599,525 Number of Sequences: 28952 Number of extensions: 298561 Number of successful extensions: 1345 Number of sequences better than 10.0: 34 Number of HSP's better than 10.0 without gapping: 1280 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1340 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1496852856 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -