BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0236 (703 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g48600.1 68418.m06011 structural maintenance of chromosomes (... 190 6e-49 At3g54670.1 68416.m06049 structural maintenance of chromosomes (... 87 8e-18 At5g62410.1 68418.m07832 SMC2-like condensin, putative (SMC2) (T... 63 2e-10 At3g47460.1 68416.m05161 SMC2-like condensin, putative similar t... 62 3e-10 At2g27170.1 68415.m06029 structural maintenance of chromosomes (... 56 2e-08 At5g61460.1 68418.m07712 structural maintenance of chromosomes (... 38 0.009 At5g07660.1 68418.m00877 structural maintenance of chromosomes (... 36 0.020 At4g19210.1 68417.m02834 RNase L inhibitor protein, putative sim... 32 0.42 At4g30300.1 68417.m04306 ABC transporter family protein ribonucl... 31 0.56 At5g09930.1 68418.m01148 ABC transporter family protein 31 0.74 At2g32240.1 68415.m03940 expressed protein contains Pfam profile... 30 1.3 At3g13640.1 68416.m01718 RNase L inhibitor protein, putative sim... 29 3.9 At3g01140.1 68416.m00018 myb family transcription factor (MYB106... 29 3.9 At5g15920.1 68418.m01862 structural maintenance of chromosomes (... 28 5.2 At1g08760.1 68414.m00975 expressed protein similar to At1g21030,... 28 5.2 At1g05320.1 68414.m00539 myosin-related similar to non-muscle my... 28 6.9 At5g54670.1 68418.m06807 kinesin-like protein C (KATC) 27 9.1 At4g11030.1 68417.m01794 long-chain-fatty-acid--CoA ligase, puta... 27 9.1 At1g30410.1 68414.m03717 ATP-binding cassette transport protein,... 27 9.1 >At5g48600.1 68418.m06011 structural maintenance of chromosomes (SMC) family protein similar to SP|P50532 Chromosome assembly protein XCAP-C {Xenopus laevis}; contains Pfam profiles PF02483: SMC family C-terminal domain, PF02463: RecF/RecN/SMC N terminal domain Length = 1241 Score = 190 bits (464), Expect = 6e-49 Identities = 91/146 (62%), Positives = 114/146 (78%) Frame = -3 Query: 683 QSKEDLYIKRAAELDEITTKRNEMRALYEQLRKKRST*FLKRIQYDTNETERDVPNDNMG 504 +SK +LY R EL+ +T +R++ R Y++LRK+R F+ + + + +G Sbjct: 1048 RSKVELYNGRVDELNSVTQERDDTRKQYDELRKRRLDEFMAGFNTISLKLKEMYQMITLG 1107 Query: 503 GDAELELVDSLDPFSEGIIFSVRPPNKSWKNISNLSGGEKTLSSLALVFALHYYKPTPLY 324 GDAELELVDSLDPFSEG++FSVRPP KSWKNI+NLSGGEKTLSSLALVFALH+YKPTPLY Sbjct: 1108 GDAELELVDSLDPFSEGVVFSVRPPKKSWKNIANLSGGEKTLSSLALVFALHHYKPTPLY 1167 Query: 323 VMDEIDAALDFKNVSIVANYIKEERR 246 VMDEIDAALDFKNVSIV +Y+K+ + Sbjct: 1168 VMDEIDAALDFKNVSIVGHYVKDRTK 1193 Score = 67.7 bits (158), Expect = 7e-12 Identities = 31/38 (81%), Positives = 37/38 (97%) Frame = -2 Query: 255 RTKNAQFIIISLRYNMFEVSNRLVGIYKTEDCTKSITI 142 RTK+AQFIIISLR NMFE+++RLVGIYKT++CTKSITI Sbjct: 1191 RTKDAQFIIISLRNNMFELADRLVGIYKTDNCTKSITI 1228 >At3g54670.1 68416.m06049 structural maintenance of chromosomes (SMC) family protein similar to SMC1 protein [Bos taurus] GI:4235253, 14S cohesin SMC1 subunit (SMC protein) [Xenopus laevis] GI:3328231; contains Pfam profiles PF02483: SMC family C-terminal domain, PF02463: RecF/RecN/SMC N terminal domain Length = 1257 Score = 87.4 bits (207), Expect = 8e-18 Identities = 39/86 (45%), Positives = 63/86 (73%) Frame = -3 Query: 509 MGGDAELELVDSLDPFSEGIIFSVRPPNKSWKNISNLSGGEKTLSSLALVFALHYYKPTP 330 +GG A L L + DPF GI ++ PP K ++++ LSGGEKT+++LAL+F++H +P+P Sbjct: 1114 LGGTAYLNLENEDDPFLHGIKYTTMPPTKRFRDMEQLSGGEKTVAALALLFSIH--RPSP 1171 Query: 329 LYVMDEIDAALDFKNVSIVANYIKEE 252 +++DE+DAALD NV+ VA +I+ + Sbjct: 1172 FFILDEVDAALDNLNVAKVAKFIRSK 1197 >At5g62410.1 68418.m07832 SMC2-like condensin, putative (SMC2) (TITAN3) very strong similarity to SMC2-like condensin (TITAN3) [Arabidopsis thaliana] GI:14279543; contains Pfam profiles PF02483: SMC family C-terminal domain, PF02463: RecF/RecN/SMC N terminal domain Length = 1175 Score = 62.9 bits (146), Expect = 2e-10 Identities = 45/145 (31%), Positives = 80/145 (55%), Gaps = 3/145 (2%) Frame = -3 Query: 683 QSKEDLYIKRAAELDEITTKRNEMRALYEQL-RKKRST*FLKRIQYDTNETERDVPNDNM 507 + ED Y ++ + I ++++ + E+L KK+ T LK N+ + + + Sbjct: 990 EKAEDEYNALISKKNTIENDKSKITKVIEELDEKKKET--LKVTWVKVNQDFGSIFSTLL 1047 Query: 506 GGD-AELELVDSLDPFSEGIIFSVRPPNKSWK-NISNLSGGEKTLSSLALVFALHYYKPT 333 G A+LE + + F +G+ V K WK ++S LSGG+++L +L+L+ AL +KP Sbjct: 1048 PGTMAKLEPPEDGN-FLDGLEVRVAF-GKVWKQSLSELSGGQRSLLALSLILALLLFKPA 1105 Query: 332 PLYVMDEIDAALDFKNVSIVANYIK 258 PLY++DE+DAALD + + I+ Sbjct: 1106 PLYILDEVDAALDLSHTQNIGRMIR 1130 >At3g47460.1 68416.m05161 SMC2-like condensin, putative similar to SMC2-like condensin (TITAN3) [Arabidopsis thaliana] GI:14279543; contains Pfam profiles PF02483: SMC family C-terminal domain, PF02463: RecF/RecN/SMC N terminal domain Length = 1171 Score = 62.5 bits (145), Expect = 3e-10 Identities = 42/144 (29%), Positives = 79/144 (54%), Gaps = 2/144 (1%) Frame = -3 Query: 683 QSKEDLYIKRAAELDEITTKRNEMRALYEQL-RKKRST*FLKRIQYDTNETERDVPNDNM 507 + ED Y + + I T +++++ + E+L KK+ T LK N+ + + + Sbjct: 987 EKAEDEYNALMTKKNIIETDKSKIKKVIEELDEKKKET--LKVTWVKVNQDFGSIFSTLL 1044 Query: 506 GGD-AELELVDSLDPFSEGIIFSVRPPNKSWKNISNLSGGEKTLSSLALVFALHYYKPTP 330 G ++LE + F +G+ V + +++S LSGG+++L +L+L+ AL +KP P Sbjct: 1045 PGTMSKLEPPEG-GTFLDGLEVRVAFGDVWKQSLSELSGGQRSLLALSLILALLLFKPAP 1103 Query: 329 LYVMDEIDAALDFKNVSIVANYIK 258 +Y++DE+DAALD + + IK Sbjct: 1104 IYILDEVDAALDLSHTQNIGRMIK 1127 >At2g27170.1 68415.m06029 structural maintenance of chromosomes (SMC) family protein similar to basement membrane-associated chondroitin proteoglycan Bamacan [Rattus norvegicus] GI:1785540; contains Pfam profile PF02463: RecF/RecN/SMC N terminal domain. No suitalble start codon was identified. Length = 1207 Score = 56.4 bits (130), Expect = 2e-08 Identities = 32/74 (43%), Positives = 44/74 (59%) Frame = -3 Query: 410 ISNLSGGEKTLSSLALVFALHYYKPTPLYVMDEIDAALDFKNVSIVANYIKEERRTLNS* 231 + LSGG+KT+ +LAL+FA+ P P Y+ DEIDAALD + + V N I RR + Sbjct: 1099 MKQLSGGQKTVVALALIFAIQRCDPAPFYLFDEIDAALDPQYRTAVGNLI---RRLADDY 1155 Query: 230 SYRFDTTCLRCRIV 189 +F TT R +V Sbjct: 1156 GTQFITTTFRPELV 1169 >At5g61460.1 68418.m07712 structural maintenance of chromosomes (SMC) family protein very strong similarity to SMC-like protein (MIM) [Arabidopsis thaliana] GI:5880614; contains Pfam profile PF02463: RecF/RecN/SMC N terminal domain Length = 1057 Score = 37.5 bits (83), Expect = 0.009 Identities = 16/41 (39%), Positives = 22/41 (53%) Frame = -3 Query: 416 KNISNLSGGEKTLSSLALVFALHYYKPTPLYVMDEIDAALD 294 ++ LSGGE++ S+L ALH P MDE D +D Sbjct: 968 RDTKGLSGGERSFSTLCFALALHEMTEAPFRAMDEFDVFMD 1008 >At5g07660.1 68418.m00877 structural maintenance of chromosomes (SMC) family protein similar to SMC-like protein (MIM) [Arabidopsis thaliana] GI:5880614; contains Pfam profile PF02463: RecF/RecN/SMC N terminal domain Length = 1058 Score = 36.3 bits (80), Expect = 0.020 Identities = 16/45 (35%), Positives = 24/45 (53%) Frame = -3 Query: 428 NKSWKNISNLSGGEKTLSSLALVFALHYYKPTPLYVMDEIDAALD 294 N + ++ LSGGE++ S+L AL P+ MDE D +D Sbjct: 965 NSAVRDTRGLSGGERSFSTLCFTLALQNMTEAPIRAMDEFDVFMD 1009 >At4g19210.1 68417.m02834 RNase L inhibitor protein, putative similar to 68 kDa protein HP68 GI:16755057 from [Triticum aestivum] Length = 605 Score = 31.9 bits (69), Expect = 0.42 Identities = 20/53 (37%), Positives = 29/53 (54%) Frame = -3 Query: 416 KNISNLSGGEKTLSSLALVFALHYYKPTPLYVMDEIDAALDFKNVSIVANYIK 258 + + NLSGGE L +AL L KP +Y++DE A LD + + + IK Sbjct: 463 QEVVNLSGGE--LQRVALTLCLG--KPADIYLIDEPSAYLDSEQRIVASKVIK 511 >At4g30300.1 68417.m04306 ABC transporter family protein ribonuclease L inhibitor - Mus musculus,PIR2:JC6555 Length = 181 Score = 31.5 bits (68), Expect = 0.56 Identities = 20/53 (37%), Positives = 28/53 (52%) Frame = -3 Query: 416 KNISNLSGGEKTLSSLALVFALHYYKPTPLYVMDEIDAALDFKNVSIVANYIK 258 K+ + LSGGEK +LAL K +Y++DE A LD + I + IK Sbjct: 111 KSFNKLSGGEKQRVALALCLG----KSADIYLIDEPSAFLDSEQRIIASKVIK 159 >At5g09930.1 68418.m01148 ABC transporter family protein Length = 678 Score = 31.1 bits (67), Expect = 0.74 Identities = 20/59 (33%), Positives = 29/59 (49%) Frame = -3 Query: 416 KNISNLSGGEKTLSSLALVFALHYYKPTPLYVMDEIDAALDFKNVSIVANYIKEERRTL 240 + +S LSGGEK L F KP+ L V+DE LD + ++ I E + T+ Sbjct: 525 RKVSLLSGGEKA----RLAFCKFMVKPSTLLVLDEPTNHLDIPSKEMLEEAINEYKGTV 579 >At2g32240.1 68415.m03940 expressed protein contains Pfam profile: PF04508 viral A-type inclusion protein repeat Length = 775 Score = 30.3 bits (65), Expect = 1.3 Identities = 13/31 (41%), Positives = 21/31 (67%) Frame = -3 Query: 683 QSKEDLYIKRAAELDEITTKRNEMRALYEQL 591 +S E+ ++ E+DE TTKR E+ AL++ L Sbjct: 212 KSAEESLEQKGREIDEATTKRMELEALHQSL 242 >At3g13640.1 68416.m01718 RNase L inhibitor protein, putative similar to 68 kDa protein HP68 GI:16755057 from [Triticum aestivum] Length = 603 Score = 28.7 bits (61), Expect = 3.9 Identities = 17/51 (33%), Positives = 25/51 (49%) Frame = -3 Query: 410 ISNLSGGEKTLSSLALVFALHYYKPTPLYVMDEIDAALDFKNVSIVANYIK 258 + LSGGEK ++ L KP +Y++DE A LD + + IK Sbjct: 463 VKTLSGGEKQRVAITLCLG----KPADIYLIDEPSAHLDSEQRITASKVIK 509 >At3g01140.1 68416.m00018 myb family transcription factor (MYB106) similar to transforming protein (myb) homolog GB:S26605 from [Petunia x hybrida] Length = 345 Score = 28.7 bits (61), Expect = 3.9 Identities = 18/62 (29%), Positives = 29/62 (46%), Gaps = 1/62 (1%) Frame = -3 Query: 545 TNETERDVPNDNMG-GDAELELVDSLDPFSEGIIFSVRPPNKSWKNISNLSGGEKTLSSL 369 T +T + N G GD +LE S FSE ++ + P S +N +N + + L Sbjct: 193 TQKTSTNWTKPNQGNGDQQLESPTSTVTFSENLLMPLGIPTDSSRNRNNNNNESSAMIEL 252 Query: 368 AL 363 A+ Sbjct: 253 AV 254 >At5g15920.1 68418.m01862 structural maintenance of chromosomes (SMC) family protein (MSS2) similar to SMC-related protein MSS2 [Arabidopsis thaliana] GI:9965743; contains Pfam profiles PF02483: SMC family C-terminal domain, PF02463: RecF/RecN/SMC N terminal domain Length = 1053 Score = 28.3 bits (60), Expect = 5.2 Identities = 12/35 (34%), Positives = 22/35 (62%) Frame = -3 Query: 398 SGGEKTLSSLALVFALHYYKPTPLYVMDEIDAALD 294 SGGE+++S++ + +L P V+DEI+ +D Sbjct: 941 SGGERSVSTILYLVSLQDLTNCPFRVVDEINQGMD 975 >At1g08760.1 68414.m00975 expressed protein similar to At1g21030, At5g44890, At2g29240, At1g08740; similar to EST gb|N96641 Length = 748 Score = 28.3 bits (60), Expect = 5.2 Identities = 12/32 (37%), Positives = 19/32 (59%) Frame = -3 Query: 464 FSEGIIFSVRPPNKSWKNISNLSGGEKTLSSL 369 F +GI F + KSW+ ++ G ++T SSL Sbjct: 285 FVQGIEFGAKALRKSWEGNLDIRGSDRTKSSL 316 >At1g05320.1 68414.m00539 myosin-related similar to non-muscle myosin II heavy chain (GI:19879404) [Loligo pealei]; ESTs gb|AA042402,gb|ATTS1380 come from this gene Length = 828 Score = 27.9 bits (59), Expect = 6.9 Identities = 13/34 (38%), Positives = 21/34 (61%) Frame = -3 Query: 683 QSKEDLYIKRAAELDEITTKRNEMRALYEQLRKK 582 +S E+ K+A E+DE TT+ E+ AL++ K Sbjct: 299 KSSEERLEKQAREIDEATTRSIELEALHKHSELK 332 >At5g54670.1 68418.m06807 kinesin-like protein C (KATC) Length = 754 Score = 27.5 bits (58), Expect = 9.1 Identities = 16/64 (25%), Positives = 32/64 (50%), Gaps = 1/64 (1%) Frame = -3 Query: 671 DLYIKRAAELD-EITTKRNEMRALYEQLRKKRST*FLKRIQYDTNETERDVPNDNMGGDA 495 +L K +++ + K E+ + E+LRK + ++Q +TE+ ND++G + Sbjct: 104 ELNEKHCVDMEVSLKNKEEELNMIIEELRKNFES---VQVQLAREQTEKLAANDSLGKEK 160 Query: 494 ELEL 483 E L Sbjct: 161 EARL 164 >At4g11030.1 68417.m01794 long-chain-fatty-acid--CoA ligase, putative / long-chain acyl-CoA synthetase, putative similar to acyl-CoA synthetase (MF7P) gi:1617270 from Brassica napus Length = 666 Score = 27.5 bits (58), Expect = 9.1 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = +3 Query: 585 LPELFIKCPHFVSFSSYLVQFGG 653 +PELF CP+ + +V FGG Sbjct: 162 IPELFKTCPNSTKYMKTVVSFGG 184 >At1g30410.1 68414.m03717 ATP-binding cassette transport protein, putative similar to MgATP-energized glutathione S-conjugate pump [Arabidopsis thaliana] GI:2909781; contains Pfam profiles PF00005: ABC transporter, PF00664: ABC transporter transmembrane region Length = 1495 Score = 27.5 bits (58), Expect = 9.1 Identities = 16/51 (31%), Positives = 28/51 (54%) Frame = -3 Query: 404 NLSGGEKTLSSLALVFALHYYKPTPLYVMDEIDAALDFKNVSIVANYIKEE 252 N S G++ L SLA + + + V+DE A++D + S++ I+EE Sbjct: 1371 NFSVGQRQLLSLARALL----RRSKILVLDEATASVDVRTDSLIQRTIREE 1417 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,397,388 Number of Sequences: 28952 Number of extensions: 263356 Number of successful extensions: 787 Number of sequences better than 10.0: 19 Number of HSP's better than 10.0 without gapping: 762 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 784 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1506636208 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -