BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0234 (661 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodi... 24 3.7 AF444782-1|AAL37903.1| 576|Anopheles gambiae Toll9 protein. 24 4.9 AY825682-1|AAV70245.1| 165|Anopheles gambiae olfactory receptor... 23 6.5 AY825681-1|AAV70244.1| 165|Anopheles gambiae olfactory receptor... 23 6.5 AY825676-1|AAV70239.1| 166|Anopheles gambiae olfactory receptor... 23 6.5 AY825675-1|AAV70238.1| 166|Anopheles gambiae olfactory receptor... 23 6.5 AY825674-1|AAV70237.1| 168|Anopheles gambiae olfactory receptor... 23 6.5 AY825673-1|AAV70236.1| 168|Anopheles gambiae olfactory receptor... 23 6.5 AY825672-1|AAV70235.1| 166|Anopheles gambiae olfactory receptor... 23 6.5 AY825671-1|AAV70234.1| 166|Anopheles gambiae olfactory receptor... 23 6.5 AY825670-1|AAV70233.1| 165|Anopheles gambiae olfactory receptor... 23 6.5 AY825669-1|AAV70232.1| 165|Anopheles gambiae olfactory receptor... 23 6.5 AY825668-1|AAV70231.1| 168|Anopheles gambiae olfactory receptor... 23 6.5 AY825667-1|AAV70230.1| 168|Anopheles gambiae olfactory receptor... 23 6.5 AY825666-1|AAV70229.1| 166|Anopheles gambiae olfactory receptor... 23 6.5 AY825665-1|AAV70228.1| 166|Anopheles gambiae olfactory receptor... 23 6.5 AY825664-1|AAV70227.1| 167|Anopheles gambiae olfactory receptor... 23 6.5 AY825663-1|AAV70226.1| 167|Anopheles gambiae olfactory receptor... 23 6.5 AY825662-1|AAV70225.1| 166|Anopheles gambiae olfactory receptor... 23 6.5 AY825661-1|AAV70224.1| 166|Anopheles gambiae olfactory receptor... 23 6.5 AY825660-1|AAV70223.1| 163|Anopheles gambiae olfactory receptor... 23 6.5 AY825659-1|AAV70222.1| 163|Anopheles gambiae olfactory receptor... 23 6.5 AY825658-1|AAV70221.1| 167|Anopheles gambiae olfactory receptor... 23 6.5 AY825657-1|AAV70220.1| 167|Anopheles gambiae olfactory receptor... 23 6.5 AY825654-1|AAV70217.1| 167|Anopheles gambiae olfactory receptor... 23 6.5 AY825653-1|AAV70216.1| 167|Anopheles gambiae olfactory receptor... 23 6.5 AY825652-1|AAV70215.1| 167|Anopheles gambiae olfactory receptor... 23 6.5 AY825651-1|AAV70214.1| 167|Anopheles gambiae olfactory receptor... 23 6.5 AY825650-1|AAV70213.1| 167|Anopheles gambiae olfactory receptor... 23 6.5 AY825649-1|AAV70212.1| 167|Anopheles gambiae olfactory receptor... 23 6.5 AY825648-1|AAV70211.1| 169|Anopheles gambiae olfactory receptor... 23 6.5 AY825647-1|AAV70210.1| 169|Anopheles gambiae olfactory receptor... 23 6.5 AY825646-1|AAV70209.1| 168|Anopheles gambiae olfactory receptor... 23 6.5 AY825645-1|AAV70208.1| 168|Anopheles gambiae olfactory receptor... 23 6.5 AY825644-1|AAV70207.1| 167|Anopheles gambiae olfactory receptor... 23 6.5 AY825643-1|AAV70206.1| 167|Anopheles gambiae olfactory receptor... 23 6.5 AY825642-1|AAV70205.1| 161|Anopheles gambiae olfactory receptor... 23 6.5 AY825641-1|AAV70204.1| 161|Anopheles gambiae olfactory receptor... 23 6.5 EF382662-1|ABN54495.1| 178|Anopheles gambiae CPF family cuticle... 23 8.5 >AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodium channel alpha subunitprotein. Length = 2139 Score = 24.2 bits (50), Expect = 3.7 Identities = 9/29 (31%), Positives = 16/29 (55%) Frame = +3 Query: 9 KFSIQGFWGAINRSSYDLFPENVVLFVFS 95 +F + G WG + S++LF N + +S Sbjct: 303 EFPLDGSWGNLTDESWELFNSNDTNWFYS 331 >AF444782-1|AAL37903.1| 576|Anopheles gambiae Toll9 protein. Length = 576 Score = 23.8 bits (49), Expect = 4.9 Identities = 23/106 (21%), Positives = 43/106 (40%) Frame = +2 Query: 329 ITYNVKKVVIFSLSRLSLVHILIYRSWAYTRLRLFTAWCCH*QRAGEHAARLSGGHETRE 508 + Y + + +I + R + +++ S+ L + WC +H RL ETR Sbjct: 472 VGYGILENIISCMDRSRCLMLIVSESF------LLSHWCQFEMHLAQH--RLL---ETRR 520 Query: 509 DDDVFLRLAGAGHDNSPQGIVKELAIKRRYRWKHQSRGCSAHTWRR 646 D+ + + L P+ + L K +W +S A W+R Sbjct: 521 DELILVLLEDIPRRKCPKTLSYLLKTKTYIKWPTKSVHEQALFWKR 566 >AY825682-1|AAV70245.1| 165|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 165 Score = 23.4 bits (48), Expect = 6.5 Identities = 8/22 (36%), Positives = 16/22 (72%) Frame = -1 Query: 142 KIVLLFANRCREELIIENTNKT 77 K V++F+N+ +E+ +N N+T Sbjct: 7 KEVIVFSNKIEQEVFEQNKNRT 28 >AY825681-1|AAV70244.1| 165|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 165 Score = 23.4 bits (48), Expect = 6.5 Identities = 8/22 (36%), Positives = 16/22 (72%) Frame = -1 Query: 142 KIVLLFANRCREELIIENTNKT 77 K V++F+N+ +E+ +N N+T Sbjct: 7 KEVIVFSNKIEQEVFEQNKNRT 28 >AY825676-1|AAV70239.1| 166|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 166 Score = 23.4 bits (48), Expect = 6.5 Identities = 8/22 (36%), Positives = 16/22 (72%) Frame = -1 Query: 142 KIVLLFANRCREELIIENTNKT 77 K V++F+N+ +E+ +N N+T Sbjct: 9 KEVIVFSNKIEQEVFEQNKNRT 30 >AY825675-1|AAV70238.1| 166|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 166 Score = 23.4 bits (48), Expect = 6.5 Identities = 8/22 (36%), Positives = 16/22 (72%) Frame = -1 Query: 142 KIVLLFANRCREELIIENTNKT 77 K V++F+N+ +E+ +N N+T Sbjct: 9 KEVIVFSNKIEQEVFEQNKNRT 30 >AY825674-1|AAV70237.1| 168|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 168 Score = 23.4 bits (48), Expect = 6.5 Identities = 8/22 (36%), Positives = 16/22 (72%) Frame = -1 Query: 142 KIVLLFANRCREELIIENTNKT 77 K V++F+N+ +E+ +N N+T Sbjct: 10 KEVIVFSNKIEQEVFEQNKNRT 31 >AY825673-1|AAV70236.1| 168|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 168 Score = 23.4 bits (48), Expect = 6.5 Identities = 8/22 (36%), Positives = 16/22 (72%) Frame = -1 Query: 142 KIVLLFANRCREELIIENTNKT 77 K V++F+N+ +E+ +N N+T Sbjct: 10 KEVIVFSNKIEQEVFEQNKNRT 31 >AY825672-1|AAV70235.1| 166|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 166 Score = 23.4 bits (48), Expect = 6.5 Identities = 8/22 (36%), Positives = 16/22 (72%) Frame = -1 Query: 142 KIVLLFANRCREELIIENTNKT 77 K V++F+N+ +E+ +N N+T Sbjct: 9 KEVIVFSNKIEQEVFEQNKNRT 30 >AY825671-1|AAV70234.1| 166|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 166 Score = 23.4 bits (48), Expect = 6.5 Identities = 8/22 (36%), Positives = 16/22 (72%) Frame = -1 Query: 142 KIVLLFANRCREELIIENTNKT 77 K V++F+N+ +E+ +N N+T Sbjct: 9 KEVIVFSNKIEQEVFEQNKNRT 30 >AY825670-1|AAV70233.1| 165|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 165 Score = 23.4 bits (48), Expect = 6.5 Identities = 8/22 (36%), Positives = 16/22 (72%) Frame = -1 Query: 142 KIVLLFANRCREELIIENTNKT 77 K V++F+N+ +E+ +N N+T Sbjct: 7 KEVIVFSNKIEQEVFEQNKNRT 28 >AY825669-1|AAV70232.1| 165|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 165 Score = 23.4 bits (48), Expect = 6.5 Identities = 8/22 (36%), Positives = 16/22 (72%) Frame = -1 Query: 142 KIVLLFANRCREELIIENTNKT 77 K V++F+N+ +E+ +N N+T Sbjct: 7 KEVIVFSNKIEQEVFEQNKNRT 28 >AY825668-1|AAV70231.1| 168|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 168 Score = 23.4 bits (48), Expect = 6.5 Identities = 8/22 (36%), Positives = 16/22 (72%) Frame = -1 Query: 142 KIVLLFANRCREELIIENTNKT 77 K V++F+N+ +E+ +N N+T Sbjct: 10 KEVIVFSNKIEQEVFEQNKNRT 31 >AY825667-1|AAV70230.1| 168|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 168 Score = 23.4 bits (48), Expect = 6.5 Identities = 8/22 (36%), Positives = 16/22 (72%) Frame = -1 Query: 142 KIVLLFANRCREELIIENTNKT 77 K V++F+N+ +E+ +N N+T Sbjct: 10 KEVIVFSNKIEQEVFEQNKNRT 31 >AY825666-1|AAV70229.1| 166|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 166 Score = 23.4 bits (48), Expect = 6.5 Identities = 8/22 (36%), Positives = 16/22 (72%) Frame = -1 Query: 142 KIVLLFANRCREELIIENTNKT 77 K V++F+N+ +E+ +N N+T Sbjct: 9 KEVIVFSNKIEQEVFEQNKNRT 30 >AY825665-1|AAV70228.1| 166|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 166 Score = 23.4 bits (48), Expect = 6.5 Identities = 8/22 (36%), Positives = 16/22 (72%) Frame = -1 Query: 142 KIVLLFANRCREELIIENTNKT 77 K V++F+N+ +E+ +N N+T Sbjct: 9 KEVIVFSNKIEQEVFEQNKNRT 30 >AY825664-1|AAV70227.1| 167|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 167 Score = 23.4 bits (48), Expect = 6.5 Identities = 8/22 (36%), Positives = 16/22 (72%) Frame = -1 Query: 142 KIVLLFANRCREELIIENTNKT 77 K V++F+N+ +E+ +N N+T Sbjct: 9 KEVIVFSNKIEQEVFEQNKNRT 30 >AY825663-1|AAV70226.1| 167|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 167 Score = 23.4 bits (48), Expect = 6.5 Identities = 8/22 (36%), Positives = 16/22 (72%) Frame = -1 Query: 142 KIVLLFANRCREELIIENTNKT 77 K V++F+N+ +E+ +N N+T Sbjct: 9 KEVIVFSNKIEQEVFEQNKNRT 30 >AY825662-1|AAV70225.1| 166|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 166 Score = 23.4 bits (48), Expect = 6.5 Identities = 8/22 (36%), Positives = 16/22 (72%) Frame = -1 Query: 142 KIVLLFANRCREELIIENTNKT 77 K V++F+N+ +E+ +N N+T Sbjct: 9 KEVIVFSNKIEQEVFEQNKNRT 30 >AY825661-1|AAV70224.1| 166|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 166 Score = 23.4 bits (48), Expect = 6.5 Identities = 8/22 (36%), Positives = 16/22 (72%) Frame = -1 Query: 142 KIVLLFANRCREELIIENTNKT 77 K V++F+N+ +E+ +N N+T Sbjct: 9 KEVIVFSNKIEQEVFEQNKNRT 30 >AY825660-1|AAV70223.1| 163|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 163 Score = 23.4 bits (48), Expect = 6.5 Identities = 8/22 (36%), Positives = 16/22 (72%) Frame = -1 Query: 142 KIVLLFANRCREELIIENTNKT 77 K V++F+N+ +E+ +N N+T Sbjct: 6 KEVIVFSNKIEQEVFEQNKNRT 27 >AY825659-1|AAV70222.1| 163|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 163 Score = 23.4 bits (48), Expect = 6.5 Identities = 8/22 (36%), Positives = 16/22 (72%) Frame = -1 Query: 142 KIVLLFANRCREELIIENTNKT 77 K V++F+N+ +E+ +N N+T Sbjct: 6 KEVIVFSNKIEQEVFEQNKNRT 27 >AY825658-1|AAV70221.1| 167|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 167 Score = 23.4 bits (48), Expect = 6.5 Identities = 8/22 (36%), Positives = 16/22 (72%) Frame = -1 Query: 142 KIVLLFANRCREELIIENTNKT 77 K V++F+N+ +E+ +N N+T Sbjct: 10 KEVIVFSNKIEQEVFEQNKNRT 31 >AY825657-1|AAV70220.1| 167|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 167 Score = 23.4 bits (48), Expect = 6.5 Identities = 8/22 (36%), Positives = 16/22 (72%) Frame = -1 Query: 142 KIVLLFANRCREELIIENTNKT 77 K V++F+N+ +E+ +N N+T Sbjct: 10 KEVIVFSNKIEQEVFEQNKNRT 31 >AY825654-1|AAV70217.1| 167|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 167 Score = 23.4 bits (48), Expect = 6.5 Identities = 8/22 (36%), Positives = 16/22 (72%) Frame = -1 Query: 142 KIVLLFANRCREELIIENTNKT 77 K V++F+N+ +E+ +N N+T Sbjct: 9 KEVIVFSNKIEQEVFEQNKNRT 30 >AY825653-1|AAV70216.1| 167|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 167 Score = 23.4 bits (48), Expect = 6.5 Identities = 8/22 (36%), Positives = 16/22 (72%) Frame = -1 Query: 142 KIVLLFANRCREELIIENTNKT 77 K V++F+N+ +E+ +N N+T Sbjct: 9 KEVIVFSNKIEQEVFEQNQNRT 30 >AY825652-1|AAV70215.1| 167|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 167 Score = 23.4 bits (48), Expect = 6.5 Identities = 8/22 (36%), Positives = 16/22 (72%) Frame = -1 Query: 142 KIVLLFANRCREELIIENTNKT 77 K V++F+N+ +E+ +N N+T Sbjct: 10 KEVIVFSNKIEQEVFEQNKNRT 31 >AY825651-1|AAV70214.1| 167|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 167 Score = 23.4 bits (48), Expect = 6.5 Identities = 8/22 (36%), Positives = 16/22 (72%) Frame = -1 Query: 142 KIVLLFANRCREELIIENTNKT 77 K V++F+N+ +E+ +N N+T Sbjct: 10 KEVIVFSNKIEQEVFEQNKNRT 31 >AY825650-1|AAV70213.1| 167|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 167 Score = 23.4 bits (48), Expect = 6.5 Identities = 8/22 (36%), Positives = 16/22 (72%) Frame = -1 Query: 142 KIVLLFANRCREELIIENTNKT 77 K V++F+N+ +E+ +N N+T Sbjct: 9 KEVIVFSNKIEQEVFEQNKNRT 30 >AY825649-1|AAV70212.1| 167|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 167 Score = 23.4 bits (48), Expect = 6.5 Identities = 8/22 (36%), Positives = 16/22 (72%) Frame = -1 Query: 142 KIVLLFANRCREELIIENTNKT 77 K V++F+N+ +E+ +N N+T Sbjct: 9 KEVIVFSNKIEQEVFEQNKNRT 30 >AY825648-1|AAV70211.1| 169|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 169 Score = 23.4 bits (48), Expect = 6.5 Identities = 8/22 (36%), Positives = 16/22 (72%) Frame = -1 Query: 142 KIVLLFANRCREELIIENTNKT 77 K V++F+N+ +E+ +N N+T Sbjct: 12 KEVIVFSNKIEQEVFEQNKNRT 33 >AY825647-1|AAV70210.1| 169|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 169 Score = 23.4 bits (48), Expect = 6.5 Identities = 8/22 (36%), Positives = 16/22 (72%) Frame = -1 Query: 142 KIVLLFANRCREELIIENTNKT 77 K V++F+N+ +E+ +N N+T Sbjct: 12 KEVIVFSNKIEQEVFEQNKNRT 33 >AY825646-1|AAV70209.1| 168|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 168 Score = 23.4 bits (48), Expect = 6.5 Identities = 8/22 (36%), Positives = 16/22 (72%) Frame = -1 Query: 142 KIVLLFANRCREELIIENTNKT 77 K V++F+N+ +E+ +N N+T Sbjct: 10 KEVIVFSNKIEQEVFEQNKNRT 31 >AY825645-1|AAV70208.1| 168|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 168 Score = 23.4 bits (48), Expect = 6.5 Identities = 8/22 (36%), Positives = 16/22 (72%) Frame = -1 Query: 142 KIVLLFANRCREELIIENTNKT 77 K V++F+N+ +E+ +N N+T Sbjct: 10 KEVIVFSNKIEQEVFEQNKNRT 31 >AY825644-1|AAV70207.1| 167|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 167 Score = 23.4 bits (48), Expect = 6.5 Identities = 8/22 (36%), Positives = 16/22 (72%) Frame = -1 Query: 142 KIVLLFANRCREELIIENTNKT 77 K V++F+N+ +E+ +N N+T Sbjct: 10 KEVIVFSNKIEQEVFEQNKNRT 31 >AY825643-1|AAV70206.1| 167|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 167 Score = 23.4 bits (48), Expect = 6.5 Identities = 8/22 (36%), Positives = 16/22 (72%) Frame = -1 Query: 142 KIVLLFANRCREELIIENTNKT 77 K V++F+N+ +E+ +N N+T Sbjct: 10 KEVIVFSNKIEQEVFEQNKNRT 31 >AY825642-1|AAV70205.1| 161|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 161 Score = 23.4 bits (48), Expect = 6.5 Identities = 8/22 (36%), Positives = 16/22 (72%) Frame = -1 Query: 142 KIVLLFANRCREELIIENTNKT 77 K V++F+N+ +E+ +N N+T Sbjct: 4 KEVIVFSNKIEQEVFEQNKNRT 25 >AY825641-1|AAV70204.1| 161|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 161 Score = 23.4 bits (48), Expect = 6.5 Identities = 8/22 (36%), Positives = 16/22 (72%) Frame = -1 Query: 142 KIVLLFANRCREELIIENTNKT 77 K V++F+N+ +E+ +N N+T Sbjct: 4 KEVIVFSNKIEQEVFEQNKNRT 25 >EF382662-1|ABN54495.1| 178|Anopheles gambiae CPF family cuticle protein protein. Length = 178 Score = 23.0 bits (47), Expect = 8.5 Identities = 14/26 (53%), Positives = 16/26 (61%) Frame = -1 Query: 514 VVLARLVAPGEAGGVLAGSLSVATPS 437 V+LA LVA AGG A S+A PS Sbjct: 6 VILAALVAAVSAGGPAA--YSIAAPS 29 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 672,122 Number of Sequences: 2352 Number of extensions: 13106 Number of successful extensions: 72 Number of sequences better than 10.0: 39 Number of HSP's better than 10.0 without gapping: 70 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 72 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 65650335 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -