BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0231 (721 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_57649| Best HMM Match : RPE65 (HMM E-Value=9) 31 1.2 SB_35734| Best HMM Match : Extensin_2 (HMM E-Value=0.52) 29 5.0 >SB_57649| Best HMM Match : RPE65 (HMM E-Value=9) Length = 309 Score = 30.7 bits (66), Expect = 1.2 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 397 NVSV*LQRLPHS*NASLLHGRNRQDGGTYPCGVTRGPT 284 N V Q P + ++SL H + QDG Y G TRGP+ Sbjct: 20 NDGVISQARPTTIHSSLAHPHSAQDGTFYNFGATRGPS 57 >SB_35734| Best HMM Match : Extensin_2 (HMM E-Value=0.52) Length = 460 Score = 28.7 bits (61), Expect = 5.0 Identities = 13/30 (43%), Positives = 15/30 (50%) Frame = +3 Query: 84 AVGRLVSPRGYAPPSRLFPPRSSNAFRFEG 173 AV + P GY PPSR F S+ F G Sbjct: 349 AVPKSTKPEGYRPPSRKFEGESTMQSHFRG 378 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,655,739 Number of Sequences: 59808 Number of extensions: 444211 Number of successful extensions: 839 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 756 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 839 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1913853903 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -