BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0228 (697 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g26490.1 68416.m03304 phototropic-responsive NPH3 family prot... 31 0.96 At3g59020.1 68416.m06578 importin beta-2 subunit family protein ... 27 9.0 At2g43990.1 68415.m05470 expressed protein 27 9.0 At2g31660.1 68415.m03865 importin beta-2 subunit family protein ... 27 9.0 At2g07749.1 68415.m00892 hypothetical protein contains Pfam prof... 27 9.0 At1g58320.1 68414.m06634 hypothetical protein similar to PGPS/D1... 27 9.0 >At3g26490.1 68416.m03304 phototropic-responsive NPH3 family protein contains NPH3 family domain, Pfam:PF03000 Length = 588 Score = 30.7 bits (66), Expect = 0.96 Identities = 18/44 (40%), Positives = 25/44 (56%), Gaps = 3/44 (6%) Frame = +3 Query: 198 LPVFVYFCPFS---DVKATIRYTKILPVWPKDLGSYYCFCCEAI 320 L +F+ C F D T++ TK+LP+W +DLG C EAI Sbjct: 130 LELFLTTCVFKSWRDSYVTLQTTKVLPLWSEDLG-ITNRCIEAI 172 >At3g59020.1 68416.m06578 importin beta-2 subunit family protein similar to D-Importin 7/RanBP7 [Drosophila melanogaster] GI:7542336; contains Pfam profile PF03810: Importin-beta N-terminal domain Length = 1112 Score = 27.5 bits (58), Expect = 9.0 Identities = 13/56 (23%), Positives = 31/56 (55%) Frame = +1 Query: 529 YNKMSKSTLSLIKCKQPDFSLTLYQLSLRSVIVIAVFANIDITNIDTSYRFSTVVM 696 +N +S+ T + CK+PD+ L+ + + V+ NID ++++ + + +V+ Sbjct: 785 HNYISRGTGHYLTCKEPDYQQNLWNV----ISVLMANKNIDDSDLEPAPKLLGIVL 836 >At2g43990.1 68415.m05470 expressed protein Length = 632 Score = 27.5 bits (58), Expect = 9.0 Identities = 13/35 (37%), Positives = 23/35 (65%) Frame = -1 Query: 289 PKSFGQTGSILVYRIVALTSENGQKYTNTGSVQDQ 185 P S +TGS L+YR + +++G+ +N+ S QD+ Sbjct: 198 PVSKLETGSDLIYRRKSEATDDGRLSSNSSSYQDR 232 >At2g31660.1 68415.m03865 importin beta-2 subunit family protein similar to D-Importin 7/RanBP7 [Drosophila melanogaster] GI:7542336; contains Pfam profile PF03810: Importin-beta N-terminal domain Length = 1040 Score = 27.5 bits (58), Expect = 9.0 Identities = 14/54 (25%), Positives = 29/54 (53%) Frame = +1 Query: 532 NKMSKSTLSLIKCKQPDFSLTLYQLSLRSVIVIAVFANIDITNIDTSYRFSTVV 693 N +S+ T + CK+PD+ +LY + + + NI+ + I+++ + VV Sbjct: 708 NFISRGTAHFLTCKEPDYQQSLYNV----LSTLMTDRNIEDSEIESAPKLIEVV 757 >At2g07749.1 68415.m00892 hypothetical protein contains Pfam profile PF05919: Mitovirus RNA-dependent RNA polymerase Length = 246 Score = 27.5 bits (58), Expect = 9.0 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = -1 Query: 475 KSSSSRHRIGVCFIAQDPLGLSGSWIL 395 KS + RH V F+A PLG GSW L Sbjct: 71 KSVTGRHD-EVVFVAGQPLGYYGSWAL 96 >At1g58320.1 68414.m06634 hypothetical protein similar to PGPS/D12 [Petunia x hybrida] GI:4105794; contains Pfam profile PF04749: Protein of unknown function, DUF614 Length = 148 Score = 27.5 bits (58), Expect = 9.0 Identities = 11/33 (33%), Positives = 18/33 (54%) Frame = +3 Query: 228 SDVKATIRYTKILPVWPKDLGSYYCFCCEAIIS 326 S +A +R+ LP P G+ +CFCC ++ Sbjct: 78 SKYRAKLRHQYALPEAPCADGAIHCFCCPCALT 110 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,419,560 Number of Sequences: 28952 Number of extensions: 289187 Number of successful extensions: 591 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 577 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 590 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1487069504 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -